BLASTX nr result
ID: Cinnamomum25_contig00038857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038857 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM99374.1| hypothetical protein AMTR_s00235p00022600 [Ambore... 64 5e-08 >gb|ERM99374.1| hypothetical protein AMTR_s00235p00022600 [Amborella trichopoda] Length = 275 Score = 63.5 bits (153), Expect = 5e-08 Identities = 36/52 (69%), Positives = 38/52 (73%) Frame = -3 Query: 294 RNNSSIDLFQEELVLVDRSSGQIPTLGGTCLWIELELYDFGLGWMEQVRA*P 139 R NSSI+ FQEE +LVDRSSG L GT LWIE ELYD LGWMEQVR P Sbjct: 59 RKNSSINRFQEE-ILVDRSSG----LSGTYLWIEQELYDVRLGWMEQVRPSP 105