BLASTX nr result
ID: Cinnamomum25_contig00038172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00038172 (242 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010663683.1| PREDICTED: protection of telomeres protein 1... 62 1e-07 emb|CBI15581.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_010099743.1| Protection of telomeres protein 1 [Morus not... 58 2e-06 >ref|XP_010663683.1| PREDICTED: protection of telomeres protein 1b-like isoform X1 [Vitis vinifera] Length = 463 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -2 Query: 145 LALRDAMISPNMKVNLLAVVVESGVPKKSKGTDYVCTLKIMDASDRKS 2 +A+ DAM S N KVN++ VVVE G+PK+SKGTD CT+KI+D S R S Sbjct: 10 MAIEDAMASLNQKVNIIGVVVEMGMPKRSKGTDCFCTVKIVDQSHRSS 57 >emb|CBI15581.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = -2 Query: 145 LALRDAMISPNMKVNLLAVVVESGVPKKSKGTDYVCTLKIMDASDRKS 2 +A+ DAM S N KVN++ VVVE G+PK+SKGTD CT+KI+D S R S Sbjct: 38 MAIEDAMASLNQKVNIIGVVVEMGMPKRSKGTDCFCTVKIVDQSHRSS 85 >ref|XP_010099743.1| Protection of telomeres protein 1 [Morus notabilis] gi|587891708|gb|EXB80320.1| Protection of telomeres protein 1 [Morus notabilis] Length = 466 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = -2 Query: 145 LALRDAMISPNMKVNLLAVVVESGVPKKSKGTDYVCTLKIMDASDRK 5 L +RDA+ S N KV+L+ V++E G PKK+KGTD CTLKI+D S +K Sbjct: 10 LEIRDAIASINQKVSLIGVIIECGFPKKTKGTDCFCTLKIVDQSYQK 56