BLASTX nr result
ID: Cinnamomum25_contig00037660
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00037660 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN37407.1| Protein transport protein Sec24-like [Glycine soja] 57 5e-06 gb|KHN11476.1| Protein transport protein Sec24-like [Glycine soja] 57 5e-06 ref|XP_004497168.1| PREDICTED: protein transport protein Sec24-l... 57 5e-06 ref|XP_003555218.1| PREDICTED: protein transport protein Sec24-l... 57 5e-06 ref|XP_003535751.1| PREDICTED: protein transport protein Sec24-l... 57 5e-06 gb|KEH44334.1| protein transporter Sec24-like CEF protein, putat... 57 6e-06 ref|XP_002962022.1| hypothetical protein SELMODRAFT_140536 [Sela... 56 8e-06 ref|XP_002971069.1| hypothetical protein SELMODRAFT_147587 [Sela... 56 8e-06 >gb|KHN37407.1| Protein transport protein Sec24-like [Glycine soja] Length = 1085 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++CSRCKA IN FM FIDQGRRFI Sbjct: 406 PIQVVDFGESGPVRCSRCKAYINPFMKFIDQGRRFI 441 >gb|KHN11476.1| Protein transport protein Sec24-like [Glycine soja] Length = 1085 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++CSRCKA IN FM FIDQGRRFI Sbjct: 406 PIQVVDFGESGPVRCSRCKAYINPFMKFIDQGRRFI 441 >ref|XP_004497168.1| PREDICTED: protein transport protein Sec24-like At4g32640 [Cicer arietinum] Length = 1077 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++CSRCKA IN FM FIDQGRRFI Sbjct: 400 PIQVVDFGESGPVRCSRCKAYINPFMKFIDQGRRFI 435 >ref|XP_003555218.1| PREDICTED: protein transport protein Sec24-like At4g32640-like [Glycine max] Length = 1087 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++CSRCKA IN FM FIDQGRRFI Sbjct: 408 PIQVVDFGESGPVRCSRCKAYINPFMKFIDQGRRFI 443 >ref|XP_003535751.1| PREDICTED: protein transport protein Sec24-like At4g32640-like [Glycine max] Length = 1085 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++CSRCKA IN FM FIDQGRRFI Sbjct: 406 PIQVVDFGESGPVRCSRCKAYINPFMKFIDQGRRFI 441 >gb|KEH44334.1| protein transporter Sec24-like CEF protein, putative [Medicago truncatula] Length = 1111 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++CSRCKA +N FM FIDQGRRFI Sbjct: 433 PIQVVDFGESGPVRCSRCKAYVNPFMKFIDQGRRFI 468 >ref|XP_002962022.1| hypothetical protein SELMODRAFT_140536 [Selaginella moellendorffii] gi|300170681|gb|EFJ37282.1| hypothetical protein SELMODRAFT_140536 [Selaginella moellendorffii] Length = 979 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++C+RCKA IN+FM FIDQGRRF+ Sbjct: 304 PIKVVDFGESGPVRCNRCKAYINSFMKFIDQGRRFV 339 >ref|XP_002971069.1| hypothetical protein SELMODRAFT_147587 [Selaginella moellendorffii] gi|300161051|gb|EFJ27667.1| hypothetical protein SELMODRAFT_147587 [Selaginella moellendorffii] Length = 977 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 209 PISVVDFVLSGHIQCSRCKA*INTFMNFIDQGRRFI 102 PI VVDF SG ++C+RCKA IN+FM FIDQGRRF+ Sbjct: 304 PIKVVDFGESGPVRCNRCKAYINSFMKFIDQGRRFV 339