BLASTX nr result
ID: Cinnamomum25_contig00036574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00036574 (242 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-... 153 4e-35 ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic ... 153 4e-35 ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cyt... 153 5e-35 gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum] 152 1e-34 ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cyt... 152 1e-34 ref|XP_002524184.1| aconitase, putative [Ricinus communis] gi|22... 152 1e-34 ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondr... 151 2e-34 ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic ... 151 2e-34 ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prun... 151 2e-34 gb|ADZ57218.1| aconitase protein [Litchi chinensis] 151 2e-34 ref|XP_011620315.1| PREDICTED: aconitate hydratase, cytoplasmic ... 150 2e-34 gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partia... 150 2e-34 ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cyt... 150 3e-34 ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cyt... 150 3e-34 ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic ... 150 3e-34 ref|XP_012089852.1| PREDICTED: aconitate hydratase, cytoplasmic ... 150 3e-34 ref|XP_007045642.1| Aconitase 3 [Theobroma cacao] gi|508709577|g... 150 3e-34 ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic ... 150 3e-34 ref|XP_004974379.2| PREDICTED: putative aconitate hydratase, cyt... 150 4e-34 ref|XP_012443822.1| PREDICTED: aconitate hydratase, cytoplasmic-... 150 4e-34 >ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera] Length = 997 Score = 153 bits (387), Expect = 4e-35 Identities = 75/80 (93%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIEAYLRANKMF Sbjct: 387 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMF 446 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLELDL Sbjct: 447 VDYNEPQQERVYSSYLELDL 466 >ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera] Length = 992 Score = 153 bits (387), Expect = 4e-35 Identities = 75/80 (93%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIEAYLRANKMF Sbjct: 382 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMF 441 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLELDL Sbjct: 442 VDYNEPQQERVYSSYLELDL 461 >ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata subsp. malaccensis] Length = 993 Score = 153 bits (386), Expect = 5e-35 Identities = 75/80 (93%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVS+IEAYLRANKMF Sbjct: 381 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSLIEAYLRANKMF 440 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLELDL Sbjct: 441 VDYNEPQKERVYSSYLELDL 460 >gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum] Length = 993 Score = 152 bits (383), Expect = 1e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 383 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 442 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E YSSYL+LDL Sbjct: 443 VDYNEPQQERAYSSYLQLDL 462 >ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata subsp. malaccensis] Length = 1003 Score = 152 bits (383), Expect = 1e-34 Identities = 75/80 (93%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 391 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 450 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDY EP+ E VYSSYLELDL Sbjct: 451 VDYTEPQKERVYSSYLELDL 470 >ref|XP_002524184.1| aconitase, putative [Ricinus communis] gi|223536553|gb|EEF38199.1| aconitase, putative [Ricinus communis] Length = 997 Score = 152 bits (383), Expect = 1e-34 Identities = 73/80 (91%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ET+SMIE+YLRANKMF Sbjct: 386 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETISMIESYLRANKMF 445 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYL+LDL Sbjct: 446 VDYNEPQQERVYSSYLQLDL 465 >ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya hassleriana] Length = 658 Score = 151 bits (381), Expect = 2e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GM ELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIE+YLRANKMF Sbjct: 48 GMSELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMF 107 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLELDL Sbjct: 108 VDYNEPQQERVYSSYLELDL 127 >ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya hassleriana] Length = 998 Score = 151 bits (381), Expect = 2e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GM ELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIE+YLRANKMF Sbjct: 388 GMSELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMF 447 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLELDL Sbjct: 448 VDYNEPQQERVYSSYLELDL 467 >ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica] gi|462413294|gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica] Length = 996 Score = 151 bits (381), Expect = 2e-34 Identities = 74/80 (92%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIE+YLRANK+F Sbjct: 386 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIESYLRANKLF 445 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLEL+L Sbjct: 446 VDYNEPQSERVYSSYLELNL 465 >gb|ADZ57218.1| aconitase protein [Litchi chinensis] Length = 883 Score = 151 bits (381), Expect = 2e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIE YLRANKMF Sbjct: 273 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEGYLRANKMF 332 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLEL+L Sbjct: 333 VDYNEPQQERVYSSYLELNL 352 >ref|XP_011620315.1| PREDICTED: aconitate hydratase, cytoplasmic [Amborella trichopoda] Length = 997 Score = 150 bits (380), Expect = 2e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 384 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 443 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDY EP+ E VYSSYL+LDL Sbjct: 444 VDYKEPQTERVYSSYLQLDL 463 >gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella trichopoda] Length = 854 Score = 150 bits (380), Expect = 2e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 266 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 325 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDY EP+ E VYSSYL+LDL Sbjct: 326 VDYKEPQTERVYSSYLQLDL 345 >ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum indicum] Length = 898 Score = 150 bits (379), Expect = 3e-34 Identities = 73/80 (91%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMG+LSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIEAYLRAN MF Sbjct: 288 GMGQLSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMF 347 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLELDL Sbjct: 348 VDYNEPQQERVYSSYLELDL 367 >ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix dactylifera] Length = 1010 Score = 150 bits (379), Expect = 3e-34 Identities = 73/80 (91%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIE+YLRANKMF Sbjct: 398 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMF 457 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDY EP++E VYSSYLELDL Sbjct: 458 VDYREPQVERVYSSYLELDL 477 >ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo] Length = 989 Score = 150 bits (379), Expect = 3e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GM ELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 379 GMEELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 438 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYL+LDL Sbjct: 439 VDYNEPQQERVYSSYLQLDL 458 >ref|XP_012089852.1| PREDICTED: aconitate hydratase, cytoplasmic [Jatropha curcas] gi|643706801|gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas] Length = 998 Score = 150 bits (379), Expect = 3e-34 Identities = 73/80 (91%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIEAYLRANKMF Sbjct: 388 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMF 447 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYL+L+L Sbjct: 448 VDYNEPQQERVYSSYLQLNL 467 >ref|XP_007045642.1| Aconitase 3 [Theobroma cacao] gi|508709577|gb|EOY01474.1| Aconitase 3 [Theobroma cacao] Length = 995 Score = 150 bits (379), Expect = 3e-34 Identities = 73/80 (91%), Positives = 78/80 (97%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIE+YLRANKMF Sbjct: 385 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMF 444 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYLEL+L Sbjct: 445 VDYNEPQQERVYSSYLELNL 464 >ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis sativus] gi|700188288|gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus] Length = 989 Score = 150 bits (379), Expect = 3e-34 Identities = 74/80 (92%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GM ELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 379 GMEELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 438 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E VYSSYL+LDL Sbjct: 439 VDYNEPQQERVYSSYLQLDL 458 >ref|XP_004974379.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Setaria italica] Length = 983 Score = 150 bits (378), Expect = 4e-34 Identities = 73/80 (91%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMG+LSLADRATIANMSPEYGATMGFFPVDHVTL YLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 373 GMGKLSLADRATIANMSPEYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANKMF 432 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDYNEP+ E +YSSYLELDL Sbjct: 433 VDYNEPQPERIYSSYLELDL 452 >ref|XP_012443822.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X2 [Gossypium raimondii] Length = 993 Score = 150 bits (378), Expect = 4e-34 Identities = 73/80 (91%), Positives = 77/80 (96%) Frame = -2 Query: 241 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSEETVSMIEAYLRANKMF 62 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRS+ETVSMIEAYLRANKMF Sbjct: 383 GMGELSLADRATIANMSPEYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMF 442 Query: 61 VDYNEPRMESVYSSYLELDL 2 VDY+EP+ E YSSYL+LDL Sbjct: 443 VDYDEPQQERAYSSYLQLDL 462