BLASTX nr result
ID: Cinnamomum25_contig00035783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00035783 (472 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009788905.1| PREDICTED: endoglucanase 17-like [Nicotiana ... 61 3e-07 ref|XP_009592543.1| PREDICTED: endoglucanase 17-like [Nicotiana ... 57 6e-06 >ref|XP_009788905.1| PREDICTED: endoglucanase 17-like [Nicotiana sylvestris] Length = 508 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 4/49 (8%) Frame = -3 Query: 326 LCHCAAYRIHCHLH----GTTPHFAHHNYRNTFSKSIFIFEGQRSGRLP 192 LC A+Y +HC H G PH+A HNYR+ +KSI FEGQRSG+LP Sbjct: 17 LCFTASYLLHCSAHSDHHGRHPHYASHNYRHALTKSILFFEGQRSGKLP 65 >ref|XP_009592543.1| PREDICTED: endoglucanase 17-like [Nicotiana tomentosiformis] Length = 508 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -3 Query: 326 LCHCAAYRIHCHLHGTTPHFAHHNYRNTFSKSIFIFEGQRSGRLP 192 L HC+A+ H HG PHFA +NYR+ +KSI FEGQRSG+LP Sbjct: 24 LLHCSAHPDH---HGHHPHFASYNYRDALTKSILFFEGQRSGKLP 65