BLASTX nr result
ID: Cinnamomum25_contig00035479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00035479 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520763.1| conserved hypothetical protein [Ricinus comm... 60 7e-07 >ref|XP_002520763.1| conserved hypothetical protein [Ricinus communis] gi|223540148|gb|EEF41725.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/53 (50%), Positives = 40/53 (75%) Frame = -2 Query: 238 TKSMKSALVVVCALAFGWLNTQLVFEPFLDRTRDSIERADPDARESHTSPPSD 80 TK +K A+VVV ALAFGWL ++ F+PFLD+ R +++++DP+ R+ SPP D Sbjct: 3 TKPVKQAMVVVGALAFGWLAIEMAFKPFLDKARAAMDKSDPE-RDPDDSPPKD 54