BLASTX nr result
ID: Cinnamomum25_contig00035411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00035411 (495 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010270051.1| PREDICTED: probable tyrosine-protein phospha... 79 1e-12 gb|AAX20039.1| tyrosine specific protein phosphatase family prot... 79 1e-12 ref|XP_012568574.1| PREDICTED: probable tyrosine-protein phospha... 79 2e-12 ref|XP_004491093.1| PREDICTED: probable tyrosine-protein phospha... 79 2e-12 ref|XP_007141657.1| hypothetical protein PHAVU_008G214300g [Phas... 78 3e-12 ref|XP_007141656.1| hypothetical protein PHAVU_008G214300g [Phas... 78 3e-12 ref|XP_007026209.1| Phosphotyrosine protein phosphatases superfa... 78 3e-12 ref|XP_006595833.1| PREDICTED: probable tyrosine-protein phospha... 77 3e-12 ref|XP_006595832.1| PREDICTED: probable tyrosine-protein phospha... 77 3e-12 ref|XP_003545201.1| PREDICTED: probable tyrosine-protein phospha... 77 3e-12 gb|KHN44755.1| Putative tyrosine-protein phosphatase [Glycine soja] 77 4e-12 gb|KHN38496.1| Putative tyrosine-protein phosphatase [Glycine soja] 77 4e-12 gb|KEH28316.1| tyrosine specific protein phosphatase family prot... 77 4e-12 gb|KEH28315.1| tyrosine specific protein phosphatase family prot... 77 4e-12 ref|XP_006575576.1| PREDICTED: probable tyrosine-protein phospha... 77 4e-12 gb|AFK49097.1| unknown [Medicago truncatula] 77 4e-12 ref|XP_003616881.1| Tyrosine specific protein phosphatase family... 77 4e-12 ref|XP_002275443.1| PREDICTED: probable tyrosine-protein phospha... 76 1e-11 gb|KHG10090.1| hypothetical protein F383_13854 [Gossypium arbore... 75 1e-11 ref|XP_009757974.1| PREDICTED: probable tyrosine-protein phospha... 75 1e-11 >ref|XP_010270051.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Nelumbo nucifera] Length = 207 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -2 Query: 143 AAIDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 A IDGE F+PPLNF+MVDNGVFRSGFP+ NF FL+TLGLRSI+YL Sbjct: 37 ADIDGEELFVPPLNFAMVDNGVFRSGFPDTPNFSFLQTLGLRSIVYL 83 >gb|AAX20039.1| tyrosine specific protein phosphatase family protein [Capsicum annuum] Length = 225 Score = 79.0 bits (193), Expect = 1e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -2 Query: 131 GEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 GE FFIPPLNFSMVDNG+FRSGFP+ +NF FL+TLGLRSI+YL Sbjct: 59 GEEFFIPPLNFSMVDNGIFRSGFPDVANFSFLQTLGLRSIIYL 101 >ref|XP_012568574.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 isoform X2 [Cicer arietinum] Length = 198 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 +DGE FIPPLNF+MVDNG+FRSGFP SNF FL+TLGLRSI+YL Sbjct: 51 MDGEDLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQTLGLRSIIYL 95 >ref|XP_004491093.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 isoform X1 [Cicer arietinum] Length = 219 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 +DGE FIPPLNF+MVDNG+FRSGFP SNF FL+TLGLRSI+YL Sbjct: 51 MDGEDLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQTLGLRSIIYL 95 >ref|XP_007141657.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] gi|561014790|gb|ESW13651.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] Length = 214 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 +DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 46 LDGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 90 >ref|XP_007141656.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] gi|561014789|gb|ESW13650.1| hypothetical protein PHAVU_008G214300g [Phaseolus vulgaris] Length = 194 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 +DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 46 LDGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 90 >ref|XP_007026209.1| Phosphotyrosine protein phosphatases superfamily protein [Theobroma cacao] gi|508781575|gb|EOY28831.1| Phosphotyrosine protein phosphatases superfamily protein [Theobroma cacao] Length = 199 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -2 Query: 134 DGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 DGE F+PPLNF+MVDNGVFRSGFP+++NF FLE+LGLRSI+YL Sbjct: 32 DGEELFVPPLNFAMVDNGVFRSGFPDSANFSFLESLGLRSIIYL 75 >ref|XP_006595833.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X3 [Glycine max] Length = 193 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 140 AIDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 A DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 45 ADDGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 90 >ref|XP_006595832.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X2 [Glycine max] Length = 194 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 140 AIDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 A DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 45 ADDGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 90 >ref|XP_003545201.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like isoform X1 [Glycine max] Length = 216 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 140 AIDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 A DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 45 ADDGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 90 >gb|KHN44755.1| Putative tyrosine-protein phosphatase [Glycine soja] Length = 186 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 134 DGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 19 DGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 62 >gb|KHN38496.1| Putative tyrosine-protein phosphatase [Glycine soja] Length = 186 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 134 DGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 19 DGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 62 >gb|KEH28316.1| tyrosine specific protein phosphatase family protein [Medicago truncatula] Length = 193 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 IDGE FIPPLNF+MVDNG+FRSGFP SNF FL+TLGL SI+YL Sbjct: 52 IDGEDLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQTLGLGSIIYL 96 >gb|KEH28315.1| tyrosine specific protein phosphatase family protein [Medicago truncatula] Length = 202 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 IDGE FIPPLNF+MVDNG+FRSGFP SNF FL+TLGL SI+YL Sbjct: 52 IDGEDLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQTLGLGSIIYL 96 >ref|XP_006575576.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000-like [Glycine max] Length = 208 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -2 Query: 134 DGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 DGE FIPPLNF+MVDNG+FRSGFP +NF FL+TLGLRSI+YL Sbjct: 41 DGEDLFIPPLNFAMVDNGIFRSGFPEPANFSFLQTLGLRSIIYL 84 >gb|AFK49097.1| unknown [Medicago truncatula] Length = 220 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 IDGE FIPPLNF+MVDNG+FRSGFP SNF FL+TLGL SI+YL Sbjct: 52 IDGEDLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQTLGLGSIIYL 96 >ref|XP_003616881.1| Tyrosine specific protein phosphatase family protein [Medicago truncatula] gi|355518216|gb|AES99839.1| tyrosine specific protein phosphatase family protein [Medicago truncatula] Length = 220 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 137 IDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 IDGE FIPPLNF+MVDNG+FRSGFP SNF FL+TLGL SI+YL Sbjct: 52 IDGEDLFIPPLNFAMVDNGIFRSGFPEPSNFSFLQTLGLGSIIYL 96 >ref|XP_002275443.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Vitis vinifera] Length = 210 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 134 DGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 DGE F PPLNF+MVDNG+FRSGFP+ +NF FL+TLGLRSI+YL Sbjct: 43 DGEELFTPPLNFAMVDNGIFRSGFPDTANFAFLQTLGLRSIIYL 86 >gb|KHG10090.1| hypothetical protein F383_13854 [Gossypium arboreum] gi|728848012|gb|KHG27455.1| hypothetical protein F383_14539 [Gossypium arboreum] Length = 240 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -2 Query: 143 AAIDGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 +A DGE F+PPLNF+MVD+GVFRSGFP+++NF FL +LGLRSI+YL Sbjct: 80 SATDGEELFVPPLNFAMVDDGVFRSGFPDSANFSFLRSLGLRSIIYL 126 >ref|XP_009757974.1| PREDICTED: probable tyrosine-protein phosphatase At1g05000 [Nicotiana sylvestris] Length = 249 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -2 Query: 134 DGEIFFIPPLNFSMVDNGVFRSGFPNASNFGFLETLGLRSILYL 3 +GE FIPPLNF+MVDNG+FRSGFP+ +NF FL+TLGLRSI+YL Sbjct: 62 NGEDLFIPPLNFAMVDNGIFRSGFPDLANFSFLQTLGLRSIIYL 105