BLASTX nr result
ID: Cinnamomum25_contig00034441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00034441 (560 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857591.1| PREDICTED: uncharacterized protein LOC105976... 57 4e-06 >ref|XP_012857591.1| PREDICTED: uncharacterized protein LOC105976874 [Erythranthe guttatus] Length = 966 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -3 Query: 213 PYGAPLISVQDAPQQKMGSV-CGVVVCYIMKQLTHKQVIASKLPQRVIDGLRAEIVTKFL 37 PY + ++DAPQQK GSV CGVVVCYI+KQ +Q I+ L + I +R EIV KFL Sbjct: 894 PYDEEVNLIRDAPQQKSGSVDCGVVVCYIVKQCFLQQPISYTLGVKNIPNMRKEIVEKFL 953