BLASTX nr result
ID: Cinnamomum25_contig00034199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00034199 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011626810.1| PREDICTED: F-box/kelch-repeat protein At5g15... 102 8e-20 >ref|XP_011626810.1| PREDICTED: F-box/kelch-repeat protein At5g15710-like [Amborella trichopoda] Length = 334 Score = 102 bits (255), Expect = 8e-20 Identities = 51/89 (57%), Positives = 65/89 (73%) Frame = -3 Query: 269 YFFLVSGLFLDKNTGSFRLVLVGSERMSNGSDKFVLRAEIYYSEMELWFLAISFPVNCPM 90 +FFLVSGLF +K +GSF +VLVGSE +S FVL A++Y SEM LW + SFPVN P+ Sbjct: 116 HFFLVSGLFREKTSGSFMVVLVGSELVSEELGGFVLTAKVYNSEMRLWVQSWSFPVNYPL 175 Query: 89 SPYRAISNGVLYCLSGNFPMSIVALDVES 3 SP++AISNGVLYC+ SIVA ++ S Sbjct: 176 SPWKAISNGVLYCILDQLSCSIVAFNIRS 204