BLASTX nr result
ID: Cinnamomum25_contig00034033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00034033 (379 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102270.1| Ankyrin repeat-containing protein [Morus not... 62 1e-07 >ref|XP_010102270.1| Ankyrin repeat-containing protein [Morus notabilis] gi|587905017|gb|EXB93213.1| Ankyrin repeat-containing protein [Morus notabilis] Length = 647 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/54 (50%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -1 Query: 187 DFIVQLVKKCPSAILEADNFGWNPLHYAAHVGNLGIDKELLLANDSA-AYIKTR 29 DF+ ++++KCPS+++EAD+FGW PLHYAAH+GN+ + + L N S+ YIK + Sbjct: 236 DFVGKVLRKCPSSMVEADDFGWIPLHYAAHLGNMEVVELFLEINHSSIVYIKDK 289