BLASTX nr result
ID: Cinnamomum25_contig00032748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00032748 (376 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012846196.1| PREDICTED: putative late blight resistance p... 56 8e-06 >ref|XP_012846196.1| PREDICTED: putative late blight resistance protein homolog R1B-17 [Erythranthe guttatus] gi|604318464|gb|EYU29956.1| hypothetical protein MIMGU_mgv1a001088mg [Erythranthe guttata] Length = 893 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 1/84 (1%) Frame = -1 Query: 283 VRQVREVTYDAEDIIDNFIGEAATREAYKPQVLRPFNSFVSYPMKLITDRTVGVQIQKVK 104 V+Q+R V Y+AED ID+F+ +AA +A KP L YP KL R VG +I+ ++ Sbjct: 62 VKQIRNVVYEAEDAIDSFVAQAAAHKARKP--LSKALHMFDYPAKL---RNVGREIESIR 116 Query: 103 SRISDLYS-KAFDINAFINEGGGS 35 +++ D+Y K F +N G GS Sbjct: 117 TKVKDIYEHKKFGFE-IVNVGDGS 139