BLASTX nr result
ID: Cinnamomum25_contig00032457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00032457 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMS95149.1| hypothetical protein BVRB_011870 [Beta vulgaris s... 57 3e-10 ref|XP_003614393.1| hypothetical protein MTR_5g051120 [Medicago ... 59 2e-07 >gb|KMS95149.1| hypothetical protein BVRB_011870 [Beta vulgaris subsp. vulgaris] Length = 309 Score = 57.0 bits (136), Expect(2) = 3e-10 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = +3 Query: 63 ARNSRKEVPFLTRLPTGTRRPAIATKAALAVRQQPMGSR*DPQAQPSEPI 212 AR + PF R P GTRRPA+A +AA AV +QP GS P+AQPSEPI Sbjct: 232 ARGRPPKEPFPVRPPAGTRRPALAARAARAVHRQPTGSGLKPRAQPSEPI 281 Score = 33.9 bits (76), Expect(2) = 3e-10 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 11 VGFPLSVPVLSRLFDASG 64 VGFPLSVPVLS LFDA G Sbjct: 217 VGFPLSVPVLSWLFDARG 234 >ref|XP_003614393.1| hypothetical protein MTR_5g051120 [Medicago truncatula] Length = 385 Score = 58.9 bits (141), Expect(2) = 2e-07 Identities = 36/58 (62%), Positives = 38/58 (65%) Frame = -2 Query: 176 RTHWLLADC*SRFRGDSGTTRAGWETG*EWDFLTGVSSHLHRTTDSELVRTRGIRLFN 3 RT LLADC S RG+SG TRAG T E D L H RT +SELVRTRGIRLFN Sbjct: 330 RTRRLLADCLSCSRGESGLTRAGRGTDWERDLLVLFPGH--RTVNSELVRTRGIRLFN 385 Score = 22.7 bits (47), Expect(2) = 2e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 211 IGSEGWAWGS 182 IGSEGWA GS Sbjct: 318 IGSEGWARGS 327