BLASTX nr result
ID: Cinnamomum25_contig00031984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00031984 (439 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, part... 59 1e-06 >ref|XP_007201486.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] gi|462396886|gb|EMJ02685.1| hypothetical protein PRUPE_ppa016462mg, partial [Prunus persica] Length = 983 Score = 58.9 bits (141), Expect = 1e-06 Identities = 46/135 (34%), Positives = 68/135 (50%) Frame = +1 Query: 22 PVNINGNVYKILSKMLATDLQEGV*EDFVLCLGAFVHSRQILNGVLVYSSQMNVFIQGTR 201 P+++ ++YK++SK+LA+ L+E + GAFV RQIL+ VLV N + R Sbjct: 398 PISLVTSLYKVISKVLASRLREVLGNTISQSQGAFVQKRQILDAVLV----ANEVAEEVR 453 Query: 202 RGSRSSYASKILKGL*QHGLQVSTVYKGWDWERDGLKCVIFAPPASRGLRHDDLLSQFHF 381 + R KI + + + W++ D L F A RGLR D LS F F Sbjct: 454 KQKRKGLVFKI-------DFEKAYDHVEWNFVDDVLDRKGFGFRAFRGLRQRDPLSPFLF 506 Query: 382 VLRSEAHRRMIEAAK 426 L S+ RR+IE A+ Sbjct: 507 TLVSDVLRRIIERAQ 521