BLASTX nr result
ID: Cinnamomum25_contig00031082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00031082 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007474559.1| ribosomal protein L20 (chloroplast) [Magnoli... 73 7e-11 ref|YP_004769737.1| ribosomal protein L20 [Magnolia kwangsiensis... 73 7e-11 ref|YP_740225.1| ribosomal protein L20 [Liriodendron tulipifera]... 73 7e-11 gb|AHH24297.1| ribosomal protein L20 (chloroplast) [Japonolirion... 72 2e-10 ref|YP_001542470.1| ribosomal protein L20 [Ceratophyllum demersu... 70 6e-10 ref|YP_001294375.1| ribosomal protein L20 [Dioscorea elephantipe... 70 6e-10 ref|YP_009092326.1| ribosomal protein L20 (chloroplast) [Macadam... 70 7e-10 ref|YP_001294293.1| ribosomal protein L20 [Illicium oligandrum] ... 70 7e-10 ref|YP_740588.1| ribosomal protein L20 [Platanus occidentalis] g... 70 7e-10 ref|YP_009123275.1| ribosomal protein L20 (chloroplast) [Chloran... 69 9e-10 ref|YP_001294121.1| ribosomal protein L20 [Chloranthus spicatus]... 69 9e-10 ref|YP_009130150.1| ribosomal protein L20 (chloroplast) [Carludo... 69 1e-09 ref|YP_009093823.1| ribosomal protein L20 (chloroplast) [Luzuria... 68 2e-09 ref|YP_008999904.1| ribosomal protein L20 [Petrosavia stellaris]... 68 2e-09 gb|AGE93479.1| ribosomal protein L20 [Xiphidium caeruleum] 68 2e-09 ref|YP_009139124.1| ribosomal protein L20 (chloroplast) [Dioscor... 68 3e-09 ref|YP_009130065.1| ribosomal protein L20 (chloroplast) [Campyne... 68 3e-09 ref|YP_003433998.1| ribosomal protein L20 [Typha latifolia] gi|6... 68 3e-09 ref|NP_862777.1| ribosomal protein L20 [Calycanthus floridus var... 68 3e-09 gb|AEZ49240.1| ribosomal protein L20, partial [Sparganium euryca... 68 3e-09 >ref|YP_007474559.1| ribosomal protein L20 (chloroplast) [Magnolia grandiflora] gi|372862866|gb|AEX98942.1| ribosomal protein L20 (chloroplast) [Magnolia grandiflora] gi|372863036|gb|AEX99110.1| ribosomal protein L20 (chloroplast) [Magnolia grandiflora] Length = 117 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 54 >ref|YP_004769737.1| ribosomal protein L20 [Magnolia kwangsiensis] gi|400256611|ref|YP_006576138.1| ribosomal protein L20 (chloroplast) [Magnolia denudata] gi|452848711|ref|YP_007474393.1| ribosomal protein L20 (chloroplast) [Magnolia officinalis] gi|452848794|ref|YP_007474475.1| ribosomal protein L20 (chloroplast) [Magnolia officinalis subsp. biloba] gi|619275759|ref|YP_009026904.1| ribosomal protein L20 (plastid) [Magnolia tripetala] gi|669100392|ref|YP_009048310.1| 50S ribosomal protein L20 (chloroplast) [Magnolia yunnanensis] gi|302424203|gb|ADL39079.1| ribosomal protein L20 [Magnolia kwangsiensis] gi|343887562|gb|AEM65241.1| ribosomal protein L20 [Magnolia denudata] gi|372862190|gb|AEX98274.1| ribosomal protein L20 (chloroplast) [Magnolia liliiflora] gi|372862274|gb|AEX98357.1| ribosomal protein L20 (chloroplast) [Magnolia denudata] gi|372862444|gb|AEX98525.1| ribosomal protein L20 (chloroplast) [Magnolia officinalis] gi|372862527|gb|AEX98607.1| ribosomal protein L20 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862612|gb|AEX98691.1| ribosomal protein L20 (chloroplast) [Magnolia officinalis subsp. biloba] gi|372862697|gb|AEX98775.1| ribosomal protein L20 (chloroplast) [Magnolia officinalis subsp. biloba] gi|573015555|gb|AHF72133.1| 50S ribosomal protein L20 (chloroplast) [Magnolia yunnanensis] gi|608608427|gb|AHW51981.1| ribosomal protein L20 [Magnolia tripetala] Length = 117 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 54 >ref|YP_740225.1| ribosomal protein L20 [Liriodendron tulipifera] gi|122221289|sp|Q0G9J6.1|RK20_LIRTU RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Liriodendron tulipifera] gi|113201017|gb|ABI32532.1| ribosomal protein L20 [Liriodendron tulipifera] Length = 117 Score = 73.2 bits (178), Expect = 7e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 54 >gb|AHH24297.1| ribosomal protein L20 (chloroplast) [Japonolirion osense] Length = 117 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVSTHRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSTHRDRGRQK 54 >ref|YP_001542470.1| ribosomal protein L20 [Ceratophyllum demersum] gi|215274785|sp|A8SEC6.1|RK20_CERDE RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Ceratophyllum demersum] gi|148508466|gb|ABQ81473.1| ribosomal protein L20 [Ceratophyllum demersum] gi|227481142|emb|CAP62521.1| ribosomal protein L20 [Ceratophyllum demersum] Length = 117 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT+TQQKMRALVSTHRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTSTQQKMRALVSTHRDRGRQK 54 >ref|YP_001294375.1| ribosomal protein L20 [Dioscorea elephantipes] gi|215274699|sp|A6MMN0.1|RK20_DIOEL RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Dioscorea elephantipes] gi|148668069|gb|ABR01453.1| ribosomal protein L20 [Dioscorea elephantipes] Length = 122 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVS+HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSSHRDRGRQK 54 >ref|YP_009092326.1| ribosomal protein L20 (chloroplast) [Macadamia integrifolia] gi|563321853|gb|AHB38182.1| ribosomal protein L20 (chloroplast) [Macadamia integrifolia] Length = 117 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVS HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSAHRDRGRQK 54 >ref|YP_001294293.1| ribosomal protein L20 [Illicium oligandrum] gi|215274705|sp|A6MMW7.1|RK20_ILLOL RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Illicium oligandrum] gi|147917418|gb|ABQ52542.1| ribosomal protein L20 [Illicium oligandrum] Length = 126 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVS HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSAHRDRGRQK 54 >ref|YP_740588.1| ribosomal protein L20 [Platanus occidentalis] gi|122166013|sp|Q09G23.1|RK20_PLAOC RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Platanus occidentalis] gi|114054407|gb|ABI49801.1| ribosomal protein L20 [Platanus occidentalis] Length = 117 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVS HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSAHRDRGRQK 54 >ref|YP_009123275.1| ribosomal protein L20 (chloroplast) [Chloranthus japonicus] gi|756761909|gb|AJM70024.1| ribosomal protein L20 (chloroplast) [Chloranthus japonicus] Length = 117 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT TQQKMRALVSTHRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTITQQKMRALVSTHRDRGRQK 54 >ref|YP_001294121.1| ribosomal protein L20 [Chloranthus spicatus] gi|215274693|sp|A6MME5.1|RK20_CHLSC RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Chloranthus spicatus] gi|146744211|gb|ABQ43283.1| ribosomal protein L20 [Chloranthus spicatus] Length = 117 Score = 69.3 bits (168), Expect = 9e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT TQQKMRALVSTHRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTITQQKMRALVSTHRDRGRQK 54 >ref|YP_009130150.1| ribosomal protein L20 (chloroplast) [Carludovica palmata] gi|768803819|gb|AJV88619.1| ribosomal protein L20 (chloroplast) [Carludovica palmata] Length = 121 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVS+HRDRG++K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSSHRDRGKQK 54 >ref|YP_009093823.1| ribosomal protein L20 (chloroplast) [Luzuriaga radicans] gi|695277438|gb|AIT16015.1| ribosomal protein L20 (chloroplast) [Luzuriaga radicans] Length = 118 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT+TQQKMRALVS HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTSTQQKMRALVSAHRDRGRQK 54 >ref|YP_008999904.1| ribosomal protein L20 [Petrosavia stellaris] gi|575925598|ref|YP_008999913.1| ribosomal protein L20 [Petrosavia stellaris] gi|554518485|gb|AGY95356.1| ribosomal protein L20 [Petrosavia stellaris] gi|554518494|gb|AGY95365.1| ribosomal protein L20 [Petrosavia stellaris] Length = 130 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTTTQQKMRALVST RDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTTQQKMRALVSTDRDRGRQK 54 >gb|AGE93479.1| ribosomal protein L20 [Xiphidium caeruleum] Length = 119 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTT QQKMRALVS+HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTAQQKMRALVSSHRDRGRQK 54 >ref|YP_009139124.1| ribosomal protein L20 (chloroplast) [Dioscorea zingiberensis] gi|817161672|gb|AKF33654.1| ribosomal protein L20 (chloroplast) [Dioscorea zingiberensis] Length = 123 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT TQQKMRALVS+HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTITQQKMRALVSSHRDRGRQK 54 >ref|YP_009130065.1| ribosomal protein L20 (chloroplast) [Campynema lineare] gi|768803733|gb|AJV88534.1| ribosomal protein L20 (chloroplast) [Campynema lineare] Length = 117 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRTT QQKMRALVS+HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTTIQQKMRALVSSHRDRGRQK 54 >ref|YP_003433998.1| ribosomal protein L20 [Typha latifolia] gi|69215547|gb|AAZ03851.1| ribosomal protein L20 [Typha latifolia] gi|281371795|gb|ADA63722.1| ribosomal protein L20 [Typha latifolia] Length = 117 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT TQQKMRALVS+HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTITQQKMRALVSSHRDRGRQK 54 >ref|NP_862777.1| ribosomal protein L20 [Calycanthus floridus var. glaucus] gi|68053200|sp|Q7YJV3.1|RK20_CALFG RecName: Full=50S ribosomal protein L20, chloroplastic (chloroplast) [Calycanthus floridus var. glaucus] gi|32399402|emb|CAD28744.1| ribosomal protein L20 [Calycanthus floridus var. glaucus] Length = 117 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT TQQKMRALVST RDRGRRK Sbjct: 19 LFASTFRGAHSRLTRTITQQKMRALVSTQRDRGRRK 54 >gb|AEZ49240.1| ribosomal protein L20, partial [Sparganium eurycarpum] Length = 117 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 124 LFAATFRGAHSRLTRTTTQQKMRALVSTHRDRGRRK 231 LFA+TFRGAHSRLTRT TQQKMRALVS+HRDRGR+K Sbjct: 19 LFASTFRGAHSRLTRTITQQKMRALVSSHRDRGRQK 54