BLASTX nr result
ID: Cinnamomum25_contig00028888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00028888 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078613.1| PREDICTED: 60S ribosomal protein L39 [Sesamu... 73 7e-11 gb|KHN44040.1| 60S ribosomal protein L39 [Glycine soja] 73 7e-11 ref|XP_010665831.1| PREDICTED: 60S ribosomal protein L39-3 [Beta... 73 7e-11 ref|XP_009588435.1| PREDICTED: 60S ribosomal protein L39 [Nicoti... 73 7e-11 ref|XP_008647774.1| PREDICTED: LOC100280595 isoform X1 [Zea mays] 73 7e-11 ref|XP_008679216.1| PREDICTED: 60S ribosomal protein L39 [Zea mays] 73 7e-11 emb|CDP02331.1| unnamed protein product [Coffea canephora] 73 7e-11 emb|CDP21617.1| unnamed protein product [Coffea canephora] 73 7e-11 ref|NP_001146986.1| LOC100280595 [Zea mays] gi|195606162|gb|ACG2... 73 7e-11 pdb|3J61|LL Chain l, Localization Of The Large Subunit Ribosomal... 73 7e-11 gb|EYU20493.1| hypothetical protein MIMGU_mgv1a017298mg [Erythra... 73 7e-11 ref|XP_006338352.1| PREDICTED: 60S ribosomal protein L39-3-like ... 73 7e-11 ref|XP_007012004.1| Ribosomal protein L39 family protein [Theobr... 73 7e-11 gb|EMS51669.1| 60S ribosomal protein L39 [Triticum urartu] 73 7e-11 ref|XP_004251767.1| PREDICTED: 60S ribosomal protein L39-3 [Sola... 73 7e-11 ref|NP_001174637.1| Os06g0181566 [Oryza sativa Japonica Group] g... 73 7e-11 dbj|BAD19088.1| putative 60S ribosomal protein L39 [Oryza sativa... 73 7e-11 ref|NP_001048394.1| Os02g0797200 [Oryza sativa Japonica Group] g... 73 7e-11 gb|AFW85570.1| 60S ribosomal protein L39, partial [Zea mays] 73 7e-11 gb|AEY84990.1| 60S ribosomal protein L39 [Wolffia australiana] 73 7e-11 >ref|XP_011078613.1| PREDICTED: 60S ribosomal protein L39 [Sesamum indicum] gi|747074077|ref|XP_011084019.1| PREDICTED: 60S ribosomal protein L39 [Sesamum indicum] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >gb|KHN44040.1| 60S ribosomal protein L39 [Glycine soja] Length = 119 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 86 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 116 >ref|XP_010665831.1| PREDICTED: 60S ribosomal protein L39-3 [Beta vulgaris subsp. vulgaris] gi|731352802|ref|XP_010687729.1| PREDICTED: 60S ribosomal protein L39-3 [Beta vulgaris subsp. vulgaris] gi|731363282|ref|XP_010693350.1| PREDICTED: 60S ribosomal protein L39-3 [Beta vulgaris subsp. vulgaris] gi|870846632|gb|KMS99155.1| hypothetical protein BVRB_2g047340 [Beta vulgaris subsp. vulgaris] gi|870851521|gb|KMT03568.1| hypothetical protein BVRB_8g192440 [Beta vulgaris subsp. vulgaris] gi|870868146|gb|KMT19015.1| hypothetical protein BVRB_2g031110 [Beta vulgaris subsp. vulgaris] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >ref|XP_009588435.1| PREDICTED: 60S ribosomal protein L39 [Nicotiana tomentosiformis] Length = 44 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 11 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 41 >ref|XP_008647774.1| PREDICTED: LOC100280595 isoform X1 [Zea mays] Length = 486 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 453 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 483 >ref|XP_008679216.1| PREDICTED: 60S ribosomal protein L39 [Zea mays] Length = 97 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 64 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 94 >emb|CDP02331.1| unnamed protein product [Coffea canephora] Length = 82 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 49 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 79 >emb|CDP21617.1| unnamed protein product [Coffea canephora] Length = 111 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 78 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 108 >ref|NP_001146986.1| LOC100280595 [Zea mays] gi|195606162|gb|ACG24911.1| 60S ribosomal protein L39 [Zea mays] gi|413952922|gb|AFW85571.1| 60S ribosomal protein L39 [Zea mays] gi|763759992|gb|KJB27323.1| hypothetical protein B456_004G291000 [Gossypium raimondii] Length = 35 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 2 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 32 >pdb|3J61|LL Chain l, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome gi|57471714|gb|AAW50988.1| ribosomal protein L39 [Triticum aestivum] gi|326487816|dbj|BAK05580.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326492163|dbj|BAJ98306.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326511663|dbj|BAJ91976.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|475538449|gb|EMT09251.1| 60S ribosomal protein L39 [Aegilops tauschii] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >gb|EYU20493.1| hypothetical protein MIMGU_mgv1a017298mg [Erythranthe guttata] Length = 83 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 50 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 80 >ref|XP_006338352.1| PREDICTED: 60S ribosomal protein L39-3-like [Solanum tuberosum] gi|697136961|ref|XP_009622567.1| PREDICTED: 60S ribosomal protein L39-3 [Nicotiana tomentosiformis] gi|697156984|ref|XP_009587246.1| PREDICTED: 60S ribosomal protein L39-3 [Nicotiana tomentosiformis] gi|698477282|ref|XP_009785874.1| PREDICTED: 60S ribosomal protein L39-3 [Nicotiana sylvestris] gi|698505112|ref|XP_009798022.1| PREDICTED: 60S ribosomal protein L39-3 [Nicotiana sylvestris] gi|698574711|ref|XP_009775733.1| PREDICTED: 60S ribosomal protein L39-3 [Nicotiana sylvestris] gi|747101775|ref|XP_011099027.1| PREDICTED: 60S ribosomal protein L39-3 [Sesamum indicum] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >ref|XP_007012004.1| Ribosomal protein L39 family protein [Theobroma cacao] gi|823120818|ref|XP_012440523.1| PREDICTED: 60S ribosomal protein L39-3-like [Gossypium raimondii] gi|823230122|ref|XP_012447796.1| PREDICTED: 60S ribosomal protein L39-3-like [Gossypium raimondii] gi|823265708|ref|XP_012465575.1| PREDICTED: 60S ribosomal protein L39-3-like [Gossypium raimondii] gi|508782367|gb|EOY29623.1| Ribosomal protein L39 family protein [Theobroma cacao] gi|728808949|gb|KHF98639.1| 60S ribosomal L39-3 [Gossypium arboreum] gi|728816882|gb|KHG02279.1| 60S ribosomal L39-3 [Gossypium arboreum] gi|728833874|gb|KHG13317.1| 60S ribosomal L39-3 [Gossypium arboreum] gi|763740066|gb|KJB07565.1| hypothetical protein B456_001G029900 [Gossypium raimondii] gi|763787899|gb|KJB54895.1| hypothetical protein B456_009G053600 [Gossypium raimondii] gi|763787900|gb|KJB54896.1| hypothetical protein B456_009G053600 [Gossypium raimondii] gi|763816011|gb|KJB82863.1| hypothetical protein B456_013G217800 [Gossypium raimondii] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >gb|EMS51669.1| 60S ribosomal protein L39 [Triticum urartu] Length = 76 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 43 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 73 >ref|XP_004251767.1| PREDICTED: 60S ribosomal protein L39-3 [Solanum lycopersicum] gi|565353539|ref|XP_006343687.1| PREDICTED: 60S ribosomal protein L39-3-like [Solanum tuberosum] gi|565366803|ref|XP_006350074.1| PREDICTED: 60S ribosomal protein L39-3-like [Solanum tuberosum] gi|723711973|ref|XP_010323169.1| PREDICTED: 60S ribosomal protein L39-3 [Solanum lycopersicum] gi|848855279|ref|XP_012851743.1| PREDICTED: 60S ribosomal protein L39-3 [Erythranthe guttatus] gi|848922333|ref|XP_012857694.1| PREDICTED: 60S ribosomal protein L39-3 [Erythranthe guttatus] gi|604345713|gb|EYU44210.1| hypothetical protein MIMGU_mgv1a017629mg [Erythranthe guttata] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >ref|NP_001174637.1| Os06g0181566 [Oryza sativa Japonica Group] gi|75251551|sp|Q5SMI4.1|RL393_ORYSJ RecName: Full=60S ribosomal protein L39-3 gi|55771364|dbj|BAD72315.1| 60S ribosomal protein L39 [Oryza sativa Japonica Group] gi|55773789|dbj|BAD72572.1| 60S ribosomal protein L39 [Oryza sativa Japonica Group] gi|125554313|gb|EAY99918.1| hypothetical protein OsI_21918 [Oryza sativa Indica Group] gi|125596264|gb|EAZ36044.1| hypothetical protein OsJ_20351 [Oryza sativa Japonica Group] gi|255676783|dbj|BAH93365.1| Os06g0181566 [Oryza sativa Japonica Group] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >dbj|BAD19088.1| putative 60S ribosomal protein L39 [Oryza sativa Japonica Group] Length = 118 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 85 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 115 >ref|NP_001048394.1| Os02g0797200 [Oryza sativa Japonica Group] gi|162459376|ref|NP_001105473.1| 60S ribosomal protein L39 [Zea mays] gi|242063386|ref|XP_002452982.1| hypothetical protein SORBIDRAFT_04g036030 [Sorghum bicolor] gi|242094938|ref|XP_002437959.1| hypothetical protein SORBIDRAFT_10g005510 [Sorghum bicolor] gi|356507420|ref|XP_003522465.1| PREDICTED: 60S ribosomal protein L39-2-like [Glycine max] gi|356515092|ref|XP_003526235.1| PREDICTED: 60S ribosomal protein L39-2-like isoform X1 [Glycine max] gi|356515112|ref|XP_003526245.1| PREDICTED: 60S ribosomal protein L39-2 isoform 1 [Glycine max] gi|356530615|ref|XP_003533876.1| PREDICTED: 60S ribosomal protein L39-2-like [Glycine max] gi|356556588|ref|XP_003546606.1| PREDICTED: 60S ribosomal protein L39-2-like [Glycine max] gi|502125052|ref|XP_004498777.1| PREDICTED: 60S ribosomal protein L39 [Cicer arietinum] gi|502132450|ref|XP_004501366.1| PREDICTED: 60S ribosomal protein L39 [Cicer arietinum] gi|502172688|ref|XP_004515175.1| PREDICTED: 60S ribosomal protein L39 [Cicer arietinum] gi|593269590|ref|XP_007136972.1| hypothetical protein PHAVU_009G089400g [Phaseolus vulgaris] gi|593329999|ref|XP_007138426.1| hypothetical protein PHAVU_009G207900g [Phaseolus vulgaris] gi|593783769|ref|XP_007154925.1| hypothetical protein PHAVU_003G159100g [Phaseolus vulgaris] gi|823154941|ref|XP_012477355.1| PREDICTED: 60S ribosomal protein L39 [Gossypium raimondii] gi|823154943|ref|XP_012477356.1| PREDICTED: 60S ribosomal protein L39 [Gossypium raimondii] gi|1710551|sp|P51425.1|RL39_MAIZE RecName: Full=60S ribosomal protein L39 gi|55977802|sp|P51426.2|RL392_ORYSJ RecName: Full=60S ribosomal protein L39-2 gi|306756293|sp|Q6KAJ8.2|RL391_ORYSJ RecName: Full=60S ribosomal protein L39-1 gi|1177369|emb|CAA64728.1| ribosomal protein L39 [Zea mays] gi|47497037|dbj|BAD19090.1| 60S RIBOSOMAL PROTEIN L39 [Oryza sativa Japonica Group] gi|113537925|dbj|BAF10308.1| Os02g0797200 [Oryza sativa Japonica Group] gi|125541470|gb|EAY87865.1| hypothetical protein OsI_09286 [Oryza sativa Indica Group] gi|125541472|gb|EAY87867.1| hypothetical protein OsI_09288 [Oryza sativa Indica Group] gi|125584013|gb|EAZ24944.1| hypothetical protein OsJ_08725 [Oryza sativa Japonica Group] gi|125584015|gb|EAZ24946.1| hypothetical protein OsJ_08727 [Oryza sativa Japonica Group] gi|149390885|gb|ABR25460.1| 60S ribosomal protein l39 [Oryza sativa Indica Group] gi|195609506|gb|ACG26583.1| 60S ribosomal protein L39 [Zea mays] gi|195609702|gb|ACG26681.1| 60S ribosomal protein L39 [Zea mays] gi|195609876|gb|ACG26768.1| 60S ribosomal protein L39 [Zea mays] gi|195609896|gb|ACG26778.1| 60S ribosomal protein L39 [Zea mays] gi|195609966|gb|ACG26813.1| 60S ribosomal protein L39 [Zea mays] gi|195610006|gb|ACG26833.1| 60S ribosomal protein L39 [Zea mays] gi|195610038|gb|ACG26849.1| 60S ribosomal protein L39 [Zea mays] gi|195611058|gb|ACG27359.1| 60S ribosomal protein L39 [Zea mays] gi|195612224|gb|ACG27942.1| 60S ribosomal protein L39 [Zea mays] gi|195641468|gb|ACG40202.1| 60S ribosomal protein L39 [Zea mays] gi|195643810|gb|ACG41373.1| 60S ribosomal protein L39 [Zea mays] gi|195659485|gb|ACG49210.1| 60S ribosomal protein L39 [Zea mays] gi|215767950|dbj|BAH00179.1| unnamed protein product [Oryza sativa Japonica Group] gi|215769187|dbj|BAH01416.1| unnamed protein product [Oryza sativa Japonica Group] gi|238011942|gb|ACR37006.1| unknown [Zea mays] gi|238012804|gb|ACR37437.1| unknown [Zea mays] gi|241916182|gb|EER89326.1| hypothetical protein SORBIDRAFT_10g005510 [Sorghum bicolor] gi|241932813|gb|EES05958.1| hypothetical protein SORBIDRAFT_04g036030 [Sorghum bicolor] gi|413939321|gb|AFW73872.1| 60S ribosomal protein L39 [Zea mays] gi|552562415|gb|AFW64137.2| 60S ribosomal protein L39 [Zea mays] gi|561010059|gb|ESW08966.1| hypothetical protein PHAVU_009G089400g [Phaseolus vulgaris] gi|561011513|gb|ESW10420.1| hypothetical protein PHAVU_009G207900g [Phaseolus vulgaris] gi|561028279|gb|ESW26919.1| hypothetical protein PHAVU_003G159100g [Phaseolus vulgaris] gi|728839517|gb|KHG18960.1| 60S ribosomal L39 [Gossypium arboreum] gi|734331441|gb|KHN07040.1| 60S ribosomal protein L39 [Glycine soja] gi|734396315|gb|KHN29611.1| 60S ribosomal protein L39 [Glycine soja] gi|734398673|gb|KHN30622.1| 60S ribosomal protein L39 [Glycine soja] gi|763759993|gb|KJB27324.1| hypothetical protein B456_004G291000 [Gossypium raimondii] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48 >gb|AFW85570.1| 60S ribosomal protein L39, partial [Zea mays] Length = 99 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 66 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 96 >gb|AEY84990.1| 60S ribosomal protein L39 [Wolffia australiana] Length = 51 Score = 73.2 bits (178), Expect = 7e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 229 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 137 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK Sbjct: 18 RQNRPIPYWIRMRTDNTIRYNAKRRHWRRTK 48