BLASTX nr result
ID: Cinnamomum25_contig00028261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00028261 (471 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63154.1| hypothetical protein 20.t00006 [Asparagus officin... 58 3e-06 >gb|ABD63154.1| hypothetical protein 20.t00006 [Asparagus officinalis] Length = 851 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/74 (39%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = +1 Query: 4 IQPYVPSRFALQLGFSQGVVGAPSSMVKRFGSLQDGRNAWAFYSAEDTTSMISYPVLP-- 177 I+PY+PSRFA Q + Q VG P+ + + G+L +G AW F+SA T + + P P Sbjct: 494 IEPYMPSRFARQFVYDQLYVGNPNPALAQIGNLYEGARAWYFFSAGGTHAQFTLPNSPPG 553 Query: 178 TSQTAGFTKWFVES 219 S F +WF E+ Sbjct: 554 CSAVMDFRQWFAEA 567