BLASTX nr result
ID: Cinnamomum25_contig00028183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00028183 (262 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002439386.1| hypothetical protein SORBIDRAFT_09g005590 [S... 58 3e-06 >ref|XP_002439386.1| hypothetical protein SORBIDRAFT_09g005590 [Sorghum bicolor] gi|241944671|gb|EES17816.1| hypothetical protein SORBIDRAFT_09g005590 [Sorghum bicolor] Length = 534 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/71 (43%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Frame = -3 Query: 203 MGSPWLMGLTYSDVCFAIACFFLLRSLLFQKKKRRG----NWPLVGMLPSVLRNVHRLLD 36 MG+ W + L+Y + A CF L L + RR NWP+VGMLP VL N+ RLLD Sbjct: 3 MGALWSLALSYPEFLVAALCFVSLSGLRLAVRARRQRVPVNWPVVGMLPFVLANLGRLLD 62 Query: 35 WGADVHRANGC 3 D R +GC Sbjct: 63 ATTDALRESGC 73