BLASTX nr result
ID: Cinnamomum25_contig00028099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00028099 (385 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534948.1| conserved hypothetical protein [Ricinus comm... 80 4e-13 emb|CBI36501.3| unnamed protein product [Vitis vinifera] 78 3e-12 gb|KCW56102.1| hypothetical protein EUGRSUZ_I01856 [Eucalyptus g... 63 7e-08 >ref|XP_002534948.1| conserved hypothetical protein [Ricinus communis] gi|223524314|gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -2 Query: 309 LLLAFSLPRGEGSLTYGFQAWREAKGLDFTYDQISGQP 196 LLLAFSLPRGEGSLTYGFQAWR+AKGLDFTYDQISGQP Sbjct: 77 LLLAFSLPRGEGSLTYGFQAWRKAKGLDFTYDQISGQP 114 >emb|CBI36501.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 306 LLAFSLPRGEGSLTYGFQAWREAKGLDFTYDQISGQP 196 LLAFSLP+GEGSLTYGFQAWRE KGLDFTYDQISGQP Sbjct: 238 LLAFSLPKGEGSLTYGFQAWREVKGLDFTYDQISGQP 274 >gb|KCW56102.1| hypothetical protein EUGRSUZ_I01856 [Eucalyptus grandis] Length = 217 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 282 GEGSLTYGFQAWREAKGLDFTYDQISGQ 199 GEGSLTYGFQAWREAKGLDFTYDQISGQ Sbjct: 189 GEGSLTYGFQAWREAKGLDFTYDQISGQ 216