BLASTX nr result
ID: Cinnamomum25_contig00027395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00027395 (329 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269688.1| PREDICTED: pentatricopeptide repeat-containi... 51 7e-06 >ref|XP_010269688.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Nelumbo nucifera] Length = 764 Score = 50.8 bits (120), Expect(2) = 7e-06 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = -3 Query: 105 QIWFLPETILYNHLLNMYAKSSDFIDARILFDEMP 1 ++ FLPE L+NHLLN+Y+K SDF+ A+ +FDEMP Sbjct: 45 KLGFLPEIQLFNHLLNLYSKCSDFVSAQKIFDEMP 79 Score = 25.4 bits (54), Expect(2) = 7e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 131 GKSIHAQIIKSGF 93 GKS+H QIIK GF Sbjct: 36 GKSVHGQIIKLGF 48