BLASTX nr result
ID: Cinnamomum25_contig00025915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00025915 (338 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838799.1| PREDICTED: dnaJ homolog subfamily B member 4... 98 2e-18 ref|XP_009775583.1| PREDICTED: dnaJ homolog subfamily B member 1... 96 1e-17 ref|XP_009590161.1| PREDICTED: dnaJ homolog subfamily B member 4... 96 1e-17 ref|XP_011011855.1| PREDICTED: dnaJ homolog subfamily B member 4... 95 2e-17 gb|KDO82712.1| hypothetical protein CISIN_1g022539mg [Citrus sin... 95 2e-17 ref|XP_006438556.1| hypothetical protein CICLE_v10032269mg [Citr... 95 2e-17 ref|XP_006378170.1| DNAJ heat shock family protein [Populus tric... 95 2e-17 ref|XP_001766290.1| predicted protein [Physcomitrella patens] gi... 95 2e-17 gb|ABK94880.1| unknown [Populus trichocarpa] 95 2e-17 ref|NP_176181.1| putative DNAJ heat shock protein [Arabidopsis t... 94 3e-17 emb|CDP14882.1| unnamed protein product [Coffea canephora] 94 4e-17 ref|XP_010044697.1| PREDICTED: dnaJ homolog subfamily B member 4... 94 4e-17 ref|XP_011034201.1| PREDICTED: dnaJ homolog subfamily B member 4... 94 5e-17 ref|XP_002888188.1| predicted protein [Arabidopsis lyrata subsp.... 94 5e-17 ref|XP_011087206.1| PREDICTED: dnaJ homolog subfamily B member 4... 93 6e-17 ref|XP_004485833.1| PREDICTED: dnaJ homolog subfamily B member 1... 93 6e-17 ref|XP_011071721.1| PREDICTED: dnaJ homolog subfamily B member 1... 93 8e-17 ref|XP_011071720.1| PREDICTED: dnaJ homolog subfamily B member 1... 93 8e-17 ref|XP_010451993.1| PREDICTED: dnaJ homolog subfamily B member 1... 93 8e-17 ref|XP_010423950.1| PREDICTED: dnaJ homolog subfamily B member 1... 93 8e-17 >ref|XP_006838799.1| PREDICTED: dnaJ homolog subfamily B member 4 [Amborella trichopoda] gi|769817668|ref|XP_011621582.1| PREDICTED: dnaJ homolog subfamily B member 4 [Amborella trichopoda] gi|548841305|gb|ERN01368.1| hypothetical protein AMTR_s00002p00260500 [Amborella trichopoda] Length = 344 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/69 (69%), Positives = 56/69 (81%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L VSR ATDE+LKKAY+ LA KWHPDKNPN +K+EAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNILKVSRNATDEDLKKAYRRLAMKWHPDKNPN--SKKEAEAKFKQISEAYDVLS 58 Query: 60 DPTTRQRHD 34 DP RQ +D Sbjct: 59 DPQKRQIYD 67 >ref|XP_009775583.1| PREDICTED: dnaJ homolog subfamily B member 1 [Nicotiana sylvestris] Length = 325 Score = 95.5 bits (236), Expect = 1e-17 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY+VLNV +TATD++LKKAY+ LA KWHPDKNPN K+EAEA+FK ISEAY L Sbjct: 1 MGVDYYNVLNVGKTATDDDLKKAYRKLAMKWHPDKNPN--NKKEAEAQFKQISEAYEILS 58 Query: 60 DPTTRQRHD 34 DP RQ +D Sbjct: 59 DPQKRQVYD 67 >ref|XP_009590161.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis] gi|697162718|ref|XP_009590162.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis] gi|697162720|ref|XP_009590163.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis] gi|697162722|ref|XP_009590164.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis] gi|697162724|ref|XP_009590165.1| PREDICTED: dnaJ homolog subfamily B member 4 [Nicotiana tomentosiformis] Length = 325 Score = 95.5 bits (236), Expect = 1e-17 Identities = 47/69 (68%), Positives = 55/69 (79%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY+VLNV +TATD++LKKAY+ LA KWHPDKNPN K+EAEA+FK ISEAY L Sbjct: 1 MGVDYYNVLNVGKTATDDDLKKAYRKLAMKWHPDKNPN--NKKEAEAQFKQISEAYEILS 58 Query: 60 DPTTRQRHD 34 DP RQ +D Sbjct: 59 DPQKRQVYD 67 >ref|XP_011011855.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Populus euphratica] Length = 317 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/76 (63%), Positives = 58/76 (76%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L ++R AT+E++KKAYK LA KWHPDK NP K+EAEAKFKLISEAY+ L Sbjct: 1 MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDK--NPVNKKEAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 59 DPNKRQIYDLYGEEGL 74 >gb|KDO82712.1| hypothetical protein CISIN_1g022539mg [Citrus sinensis] Length = 295 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/76 (63%), Positives = 58/76 (76%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L VSR AT+++LKK+YK LA KWHPDK NP+ Q+AEAKFKLISEAY+ L Sbjct: 1 MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDK--NPATNQQAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 59 DPRKRQIYDLYGPEGL 74 >ref|XP_006438556.1| hypothetical protein CICLE_v10032269mg [Citrus clementina] gi|568859472|ref|XP_006483263.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Citrus sinensis] gi|557540752|gb|ESR51796.1| hypothetical protein CICLE_v10032269mg [Citrus clementina] Length = 295 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/76 (63%), Positives = 58/76 (76%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L VSR AT+++LKK+YK LA KWHPDK NP+ Q+AEAKFKLISEAY+ L Sbjct: 1 MGVDYYNILKVSRGATEDDLKKSYKRLAMKWHPDK--NPATNQQAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 59 DPRKRQIYDLYGPEGL 74 >ref|XP_006378170.1| DNAJ heat shock family protein [Populus trichocarpa] gi|550329041|gb|ERP55967.1| DNAJ heat shock family protein [Populus trichocarpa] Length = 317 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/76 (63%), Positives = 58/76 (76%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L ++R AT+E++KKAYK LA KWHPDK NP K+EAEAKFKLISEAY+ L Sbjct: 1 MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDK--NPVNKKEAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 59 DPNKRQIYDLYGEEGL 74 >ref|XP_001766290.1| predicted protein [Physcomitrella patens] gi|162682504|gb|EDQ68922.1| predicted protein [Physcomitrella patens] Length = 353 Score = 95.1 bits (235), Expect = 2e-17 Identities = 49/76 (64%), Positives = 56/76 (73%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYYSVL V +TAT+++LKKAY+ LA KWHPDKNPN K+EAEAKFK ISEAY L Sbjct: 1 MGVDYYSVLKVPKTATEDDLKKAYRKLAMKWHPDKNPN--NKKEAEAKFKQISEAYEVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +D GL Sbjct: 59 DPQKRQIYDQAGEEGL 74 >gb|ABK94880.1| unknown [Populus trichocarpa] Length = 317 Score = 95.1 bits (235), Expect = 2e-17 Identities = 48/76 (63%), Positives = 58/76 (76%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L ++R AT+E++KKAYK LA KWHPDK NP K+EAEAKFKLISEAY+ L Sbjct: 1 MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDK--NPVNKKEAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 59 DPNKRQIYDLYGEEGL 74 >ref|NP_176181.1| putative DNAJ heat shock protein [Arabidopsis thaliana] gi|5080806|gb|AAD39315.1|AC007258_4 Putative heat shock protein [Arabidopsis thaliana] gi|332195488|gb|AEE33609.1| putative DNAJ heat shock protein [Arabidopsis thaliana] Length = 331 Score = 94.4 bits (233), Expect = 3e-17 Identities = 46/69 (66%), Positives = 56/69 (81%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY+VLNV+ +AT+++LKK+Y+ LA KWHPDKNP S KQEAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNVLNVNPSATEDDLKKSYRRLAMKWHPDKNPT-SIKQEAEAKFKQISEAYDVLS 59 Query: 60 DPTTRQRHD 34 DP RQ +D Sbjct: 60 DPNKRQIYD 68 >emb|CDP14882.1| unnamed protein product [Coffea canephora] Length = 368 Score = 94.0 bits (232), Expect = 4e-17 Identities = 47/70 (67%), Positives = 55/70 (78%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L V+R A+DE+LKKAY+ LA WHPDKNP S KQEAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNILKVNRNASDEDLKKAYRRLAMIWHPDKNPT-SNKQEAEAKFKQISEAYDVLS 59 Query: 60 DPTTRQRHDL 31 DP RQ +DL Sbjct: 60 DPQKRQIYDL 69 >ref|XP_010044697.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Eucalyptus grandis] gi|629122305|gb|KCW86795.1| hypothetical protein EUGRSUZ_B03403 [Eucalyptus grandis] Length = 335 Score = 94.0 bits (232), Expect = 4e-17 Identities = 48/70 (68%), Positives = 55/70 (78%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY+VL V+R ATDE+L+KAYK LA KWHPDK NP +EAEAKFKLISEAY+ L Sbjct: 1 MGVDYYNVLKVNRGATDEDLRKAYKRLAMKWHPDK--NPINHKEAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDL 31 DP RQ +DL Sbjct: 59 DPQKRQIYDL 68 >ref|XP_011034201.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Populus euphratica] Length = 314 Score = 93.6 bits (231), Expect = 5e-17 Identities = 48/76 (63%), Positives = 57/76 (75%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M DYY+VL ++R AT+E++KKAYK LA KWHPDK NP K+EAEAKFKLISEAY+ L Sbjct: 1 MGFDYYNVLKLNRNATEEDMKKAYKRLAMKWHPDK--NPVNKKEAEAKFKLISEAYDVLS 58 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 59 DPNKRQIYDLYGEEGL 74 >ref|XP_002888188.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334029|gb|EFH64447.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 334 Score = 93.6 bits (231), Expect = 5e-17 Identities = 46/69 (66%), Positives = 56/69 (81%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY+VLNV+ TAT+++LKK+Y+ LA KWHPDKNP S K+EAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNVLNVNPTATEDDLKKSYRRLAMKWHPDKNP-ASNKKEAEAKFKQISEAYDVLS 59 Query: 60 DPTTRQRHD 34 DP RQ +D Sbjct: 60 DPNKRQIYD 68 >ref|XP_011087206.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Sesamum indicum] Length = 340 Score = 93.2 bits (230), Expect = 6e-17 Identities = 49/76 (64%), Positives = 57/76 (75%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L V+R+ATDE+LKKAY+ LA WHPDKN N KQEAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNILKVNRSATDEDLKKAYRRLAIIWHPDKNAN---KQEAEAKFKQISEAYDVLS 57 Query: 60 DPTTRQRHDLGCLNGL 13 DP RQ +DL GL Sbjct: 58 DPQKRQIYDLYGEEGL 73 >ref|XP_004485833.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Cicer arietinum] Length = 337 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/69 (66%), Positives = 51/69 (73%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY +LNV + ATDEELKKAY+ LA KWHPDKNPN K+EAE KFK ISEAY L Sbjct: 1 MGVDYYKILNVDKNATDEELKKAYRKLAMKWHPDKNPN--NKKEAETKFKQISEAYEVLS 58 Query: 60 DPTTRQRHD 34 DP R +D Sbjct: 59 DPQKRAIYD 67 >ref|XP_011071721.1| PREDICTED: dnaJ homolog subfamily B member 1-like isoform X2 [Sesamum indicum] Length = 343 Score = 92.8 bits (229), Expect = 8e-17 Identities = 50/82 (60%), Positives = 59/82 (71%), Gaps = 4/82 (4%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L V+R A+DE+LKKAY+ LA WHPDKN N KQEAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNILKVNRNASDEDLKKAYRRLAMIWHPDKNVN---KQEAEAKFKQISEAYDVLS 57 Query: 60 DPTTRQRHDL----GCLNGLVP 7 DP RQ +DL G +G VP Sbjct: 58 DPQKRQIYDLYGEEGLKSGQVP 79 >ref|XP_011071720.1| PREDICTED: dnaJ homolog subfamily B member 1-like isoform X1 [Sesamum indicum] Length = 344 Score = 92.8 bits (229), Expect = 8e-17 Identities = 50/82 (60%), Positives = 59/82 (71%), Gaps = 4/82 (4%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY++L V+R A+DE+LKKAY+ LA WHPDKN N KQEAEAKFK ISEAY+ L Sbjct: 1 MGVDYYNILKVNRNASDEDLKKAYRRLAMIWHPDKNVN---KQEAEAKFKQISEAYDVLS 57 Query: 60 DPTTRQRHDL----GCLNGLVP 7 DP RQ +DL G +G VP Sbjct: 58 DPQKRQIYDLYGEEGLKSGQVP 79 >ref|XP_010451993.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Camelina sativa] Length = 335 Score = 92.8 bits (229), Expect = 8e-17 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY VL V R+A DEELKKAY+ LA KWHPDKNPN K+EAEAKFK ISEAY+ L Sbjct: 1 MGVDYYKVLQVDRSANDEELKKAYRKLAMKWHPDKNPN--NKKEAEAKFKQISEAYDVLS 58 Query: 60 DPTTRQRHD 34 DP R +D Sbjct: 59 DPQKRAIYD 67 >ref|XP_010423950.1| PREDICTED: dnaJ homolog subfamily B member 13-like [Camelina sativa] Length = 341 Score = 92.8 bits (229), Expect = 8e-17 Identities = 47/69 (68%), Positives = 52/69 (75%) Frame = -3 Query: 240 MVVDYYSVLNVSRTATDEELKKAYKTLARKWHPDKNPNPSAKQEAEAKFKLISEAYNTLC 61 M VDYY VL V R+A DEELKKAY+ LA KWHPDKNPN K+EAEAKFK ISEAY+ L Sbjct: 1 MGVDYYKVLQVDRSANDEELKKAYRKLAMKWHPDKNPN--NKKEAEAKFKQISEAYDVLS 58 Query: 60 DPTTRQRHD 34 DP R +D Sbjct: 59 DPQKRAIYD 67