BLASTX nr result
ID: Cinnamomum25_contig00025375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00025375 (265 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009045751.1| orf127d (mitochondrion) [Batis maritima] gi|... 81 2e-13 gb|EPS74719.1| hypothetical protein M569_00044, partial [Genlise... 47 5e-09 gb|KJB09801.1| hypothetical protein B456_001G167700 [Gossypium r... 61 3e-07 >ref|YP_009045751.1| orf127d (mitochondrion) [Batis maritima] gi|655168525|gb|AIC83354.1| orf127d (mitochondrion) [Batis maritima] Length = 127 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -1 Query: 262 LLEPSQEWPLVDIHHFSPVREALFNTLRKDVHRGQKDSVIGT 137 L EPSQE PLVD HHFSPVREALFNTLRKDVHRGQKDSVIGT Sbjct: 86 LSEPSQERPLVDTHHFSPVREALFNTLRKDVHRGQKDSVIGT 127 >gb|EPS74719.1| hypothetical protein M569_00044, partial [Genlisea aurea] Length = 75 Score = 47.4 bits (111), Expect(2) = 5e-09 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 208 VREALFNTLRKDVHRGQKDSVIG 140 VREALFNTLRKDVHRGQ DSVIG Sbjct: 50 VREALFNTLRKDVHRGQNDSVIG 72 Score = 39.7 bits (91), Expect(2) = 5e-09 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 263 VIGAEPGMAVSGHPPLFT 210 VIGAEPGMAV GHPPLFT Sbjct: 32 VIGAEPGMAVRGHPPLFT 49 >gb|KJB09801.1| hypothetical protein B456_001G167700 [Gossypium raimondii] Length = 268 Score = 60.8 bits (146), Expect = 3e-07 Identities = 33/49 (67%), Positives = 35/49 (71%), Gaps = 5/49 (10%) Frame = -2 Query: 135 HLRAGKRKPPRPDLPNESGRL-----LKEFTRPKGHQLSQKKGRSAAYC 4 HLRAGKRKPPRPD + R+ LKEFTR GHQLSQ KG SAAYC Sbjct: 184 HLRAGKRKPPRPDQRKQQCRIRPPLALKEFTR--GHQLSQNKGGSAAYC 230