BLASTX nr result
ID: Cinnamomum25_contig00024602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00024602 (249 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN20558.1| Endoglucanase 9 [Glycine soja] 66 8e-09 gb|KHG21292.1| 60S ribosomal protein L11-1 [Gossypium arboreum] 62 2e-07 ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobro... 62 2e-07 sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; ... 60 6e-07 ref|XP_009629723.1| PREDICTED: 60S ribosomal protein L11-1-like ... 60 6e-07 ref|XP_012447299.1| PREDICTED: 60S ribosomal protein L11 [Gossyp... 60 6e-07 gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium r... 60 6e-07 ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamu... 60 6e-07 ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [S... 60 6e-07 ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [S... 60 6e-07 ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populu... 60 6e-07 ref|XP_011033383.1| PREDICTED: 60S ribosomal protein L11-like [P... 60 6e-07 ref|XP_010936718.1| PREDICTED: 60S ribosomal protein L11 [Elaeis... 60 6e-07 gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja] 60 6e-07 gb|KHG23956.1| 60S ribosomal L11-2 -like protein [Gossypium arbo... 60 6e-07 gb|KHG21293.1| 60S ribosomal protein L11-1 [Gossypium arboreum] 60 6e-07 ref|XP_012484748.1| PREDICTED: 60S ribosomal protein L11-like [G... 60 6e-07 ref|XP_010246451.1| PREDICTED: 60S ribosomal protein L11-like [N... 60 6e-07 ref|XP_010274422.1| PREDICTED: 60S ribosomal protein L11 [Nelumb... 60 6e-07 ref|XP_009790976.1| PREDICTED: 60S ribosomal protein L11-1 [Nico... 60 6e-07 >gb|KHN20558.1| Endoglucanase 9 [Glycine soja] Length = 677 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -3 Query: 109 HTAVKAMASEKKLSNPMREIKVQKLVLNISVGESGD 2 HTA MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 491 HTAAATMASEKKLSNPMREIKVQKLVLNISVGESGD 526 >gb|KHG21292.1| 60S ribosomal protein L11-1 [Gossypium arboreum] Length = 228 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 94 AMASEKKLSNPMREIKVQKLVLNISVGESGD 2 AMASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 29 AMASEKKLSNPMREIKVQKLVLNISVGESGD 59 >ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao] gi|508780703|gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao] Length = 257 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 94 AMASEKKLSNPMREIKVQKLVLNISVGESGD 2 AMASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 75 AMASEKKLSNPMREIKVQKLVLNISVGESGD 105 >sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 [Medicago sativa] gi|463252|emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa] Length = 181 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_009629723.1| PREDICTED: 60S ribosomal protein L11-1-like [Nicotiana tomentosiformis] gi|10799832|emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] Length = 181 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_012447299.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|823234409|ref|XP_012449841.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|823236877|ref|XP_012451094.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|823248711|ref|XP_012457012.1| PREDICTED: 60S ribosomal protein L11 [Gossypium raimondii] gi|763790395|gb|KJB57391.1| hypothetical protein B456_009G161300 [Gossypium raimondii] gi|763799887|gb|KJB66842.1| hypothetical protein B456_010G160100 [Gossypium raimondii] gi|763799888|gb|KJB66843.1| hypothetical protein B456_010G160100 [Gossypium raimondii] gi|763801414|gb|KJB68369.1| hypothetical protein B456_010G241400 [Gossypium raimondii] gi|763802761|gb|KJB69699.1| hypothetical protein B456_011G038200 [Gossypium raimondii] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >gb|KJB57390.1| hypothetical protein B456_009G161300 [Gossypium raimondii] Length = 154 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_011082984.1| PREDICTED: 60S ribosomal protein L11 [Sesamum indicum] Length = 183 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_011081868.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum] Length = 183 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_011088013.1| PREDICTED: 60S ribosomal protein L11-like [Sesamum indicum] Length = 183 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_011039398.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica] gi|743891603|ref|XP_011039399.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica] gi|743891607|ref|XP_011039400.1| PREDICTED: 60S ribosomal protein L11 [Populus euphratica] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_011033383.1| PREDICTED: 60S ribosomal protein L11-like [Populus euphratica] gi|743941185|ref|XP_011015073.1| PREDICTED: 60S ribosomal protein L11-like isoform X1 [Populus euphratica] gi|743941187|ref|XP_011015074.1| PREDICTED: 60S ribosomal protein L11-like isoform X2 [Populus euphratica] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_010936718.1| PREDICTED: 60S ribosomal protein L11 [Elaeis guineensis] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >gb|KHN42782.1| 60S ribosomal protein L11 [Glycine soja] Length = 181 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >gb|KHG23956.1| 60S ribosomal L11-2 -like protein [Gossypium arboreum] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >gb|KHG21293.1| 60S ribosomal protein L11-1 [Gossypium arboreum] Length = 199 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_012484748.1| PREDICTED: 60S ribosomal protein L11-like [Gossypium raimondii] gi|728829477|gb|KHG08920.1| 60S ribosomal L11-1 -like protein [Gossypium arboreum] gi|763767692|gb|KJB34907.1| hypothetical protein B456_006G089700 [Gossypium raimondii] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_010246451.1| PREDICTED: 60S ribosomal protein L11-like [Nelumbo nucifera] Length = 183 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_010274422.1| PREDICTED: 60S ribosomal protein L11 [Nelumbo nucifera] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30 >ref|XP_009790976.1| PREDICTED: 60S ribosomal protein L11-1 [Nicotiana sylvestris] Length = 181 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 MASEKKLSNPMREIKVQKLVLNISVGESGD 2 MASEKKLSNPMREIKVQKLVLNISVGESGD Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGD 30