BLASTX nr result
ID: Cinnamomum25_contig00024560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00024560 (298 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206240.1| hypothetical protein PRUPE_ppa015514mg, part... 87 3e-15 emb|CDP07067.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_007016826.1| Pentatricopeptide repeat-containing protein,... 85 2e-14 gb|KJB56147.1| hypothetical protein B456_009G110100 [Gossypium r... 84 4e-14 ref|XP_009367029.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_008226176.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_009376068.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_010253962.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 ref|XP_008359526.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 ref|XP_002515739.1| pentatricopeptide repeat-containing protein,... 77 6e-12 ref|XP_006359568.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_011094634.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_011047939.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_009614927.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-11 ref|XP_010312424.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_009771216.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_002534209.1| pentatricopeptide repeat-containing protein,... 71 3e-10 ref|XP_012064747.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_010109469.1| hypothetical protein L484_007489 [Morus nota... 69 1e-09 ref|XP_006339300.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 >ref|XP_007206240.1| hypothetical protein PRUPE_ppa015514mg, partial [Prunus persica] gi|462401882|gb|EMJ07439.1| hypothetical protein PRUPE_ppa015514mg, partial [Prunus persica] Length = 417 Score = 87.4 bits (215), Expect = 3e-15 Identities = 45/99 (45%), Positives = 60/99 (60%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L P +LILS+P K CL FFN LLK+Q S HL+LICRL K RKF Sbjct: 14 LLSKLKPNFLNLILSDPKFKCSRCLLFFNFLLKNQSFISFKIDLHAHLTLICRLLKARKF 73 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+++ K +S+ E+ R PFSVI + + C +P++ AK Sbjct: 74 TEAEEIFKCISVDENSRYPFSVIASAAEICCLEPRVKAK 112 >emb|CDP07067.1| unnamed protein product [Coffea canephora] Length = 544 Score = 85.1 bits (209), Expect = 2e-14 Identities = 46/100 (46%), Positives = 61/100 (61%), Gaps = 1/100 (1%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L HLILS+P ++ CLDFFN L+K+Q S + HL+L+CRL K RKF Sbjct: 53 LLSKLTSNFVHLILSDPRIQIPKCLDFFNFLVKNQALLSFQLSIETHLTLLCRLVKSRKF 112 Query: 117 LIAKDLLKS-VSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+DLL++ + + E+ RCPFS I + QN P I AK Sbjct: 113 EDAEDLLRAFLILHENGRCPFSAIASFFQNNCYKPFIRAK 152 >ref|XP_007016826.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508787189|gb|EOY34445.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 561 Score = 84.7 bits (208), Expect = 2e-14 Identities = 44/95 (46%), Positives = 58/95 (61%) Frame = -2 Query: 285 LDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKFLIAK 106 L+P H IL+NP LK C FFNL++K+Q S Q HL+L CRL K R F A+ Sbjct: 145 LNPTTFHDILTNPDLKASKCFRFFNLVIKNQSLVSFKPDLQAHLTLTCRLLKARLFSDAE 204 Query: 105 DLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 +LKSVS+ ES R PF VI + ++NC + K+ K Sbjct: 205 AMLKSVSVDESLRYPFLVIASAVENCCFESKVITK 239 >gb|KJB56147.1| hypothetical protein B456_009G110100 [Gossypium raimondii] Length = 467 Score = 84.0 bits (206), Expect = 4e-14 Identities = 43/98 (43%), Positives = 58/98 (59%) Frame = -2 Query: 294 LPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKFL 115 LP+L P ILSNP LK C FFN + +Q S H Q HL LICRL K R F Sbjct: 48 LPSLTPTTFRDILSNPDLKASKCFRFFNFVANNQSLLSFKPHLQDHLILICRLLKARLFA 107 Query: 114 IAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+ +LK++S+ E+ R PF VI + ++NC + K++ K Sbjct: 108 DAEAMLKTLSVDENLRYPFLVIASAVENCCFESKVTTK 145 >ref|XP_009367029.1| PREDICTED: pentatricopeptide repeat-containing protein At2g28050-like [Pyrus x bretschneideri] Length = 464 Score = 82.0 bits (201), Expect = 1e-13 Identities = 41/99 (41%), Positives = 61/99 (61%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L+P ILS+P +T CL FFN LLK+Q S HL+++CRL + RKF Sbjct: 42 LLSKLNPNSLRFILSDPKFRTSKCLLFFNFLLKNQSLISFKIDLHAHLTILCRLLQTRKF 101 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+++L+ VS+ E+ R PF VI + ++ C +P++ AK Sbjct: 102 DDAEEILRYVSVDENTRYPFHVIASAVEICFLEPRVRAK 140 >ref|XP_008226176.1| PREDICTED: pentatricopeptide repeat-containing protein At2g28050 [Prunus mume] Length = 450 Score = 82.0 bits (201), Expect = 1e-13 Identities = 43/99 (43%), Positives = 59/99 (59%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L P +LILS+P K L FFN LLK+Q S HL+LICRL + RKF Sbjct: 47 LLSKLKPNSLNLILSDPKFKCSKSLLFFNFLLKNQSFISFKIDLHAHLTLICRLLRARKF 106 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+++ K +S+ E+ R PFSVI + + C +P++ AK Sbjct: 107 TEAEEIFKCISVDENSRYPFSVIASAAEICCLEPRVKAK 145 >ref|XP_009376068.1| PREDICTED: pentatricopeptide repeat-containing protein At2g28050-like [Pyrus x bretschneideri] Length = 447 Score = 81.3 bits (199), Expect = 2e-13 Identities = 40/99 (40%), Positives = 61/99 (61%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L+P ILS+P +T CL FFN LLK++ S HL+++CRL + RKF Sbjct: 42 LLSNLNPNSLRFILSDPKFRTSKCLLFFNFLLKNRSLISFKIDLHAHLTILCRLLQTRKF 101 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+++L+ VS+ E+ R PF VI + ++ C +P++ AK Sbjct: 102 DDAEEILRYVSVDENTRYPFHVIASAVEICCLEPRVRAK 140 >ref|XP_010253962.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Nelumbo nucifera] Length = 618 Score = 80.5 bits (197), Expect = 4e-13 Identities = 44/99 (44%), Positives = 60/99 (60%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L+P+V L+LSNP L+T++ LDFFN L + H +L+LI RLFKDR+F Sbjct: 51 LLHLLNPEVIQLVLSNPLLRTKSYLDFFNFLQWKGSTSPYQHDISAYLTLIYRLFKDRRF 110 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 +AK LL SV I E +C +V +L++N I AK Sbjct: 111 ALAKHLLNSVVINEDIKCTATVTASLLENVCDGSWIRAK 149 >ref|XP_008359526.1| PREDICTED: pentatricopeptide repeat-containing protein At2g28050 [Malus domestica] Length = 447 Score = 79.3 bits (194), Expect = 9e-13 Identities = 40/99 (40%), Positives = 60/99 (60%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L+ ILS+P +T CL FFN LLK+Q S HL+++CRL + RKF Sbjct: 42 LLSNLNXNSLRFILSDPKFRTSKCLLFFNFLLKNQSLISFKIDLHAHLTILCRLLQTRKF 101 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+++L+ VS+ E+ R PF VI + ++ C +P++ AK Sbjct: 102 DDAEEILRYVSVDENNRYPFHVIASAVEICCLEPRVRAK 140 >ref|XP_002515739.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545176|gb|EEF46686.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 613 Score = 76.6 bits (187), Expect = 6e-12 Identities = 40/99 (40%), Positives = 60/99 (60%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL LD T+L+LSNP+L T++CL+FF L K+Q + H+ LI RLFK RKF Sbjct: 48 LLSNLDSYTTNLVLSNPNLPTRSCLNFFKCLQKNQSLICHKPDLRAHVILISRLFKARKF 107 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 ++ K++L ++ ++ RC S V+L+ N +PK K Sbjct: 108 VVMKNVLTCYAMDKNLRCSVSDFVSLIDNRFHEPKFVEK 146 >ref|XP_006359568.1| PREDICTED: pentatricopeptide repeat-containing protein At2g28050-like [Solanum tuberosum] Length = 522 Score = 75.5 bits (184), Expect = 1e-11 Identities = 41/99 (41%), Positives = 59/99 (59%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL L P + LILS+PH+ T CLDFFN L+ +Q + + HL+L+CRL K+ F Sbjct: 48 LLSNLTPNLILLILSDPHINTPKCLDFFNFLMLNQSFITFKIGVETHLTLVCRLVKEGYF 107 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 A+ LL V E+ RCPF+VI + +N + K ++K Sbjct: 108 EDAETLLVLVPNIETFRCPFAVIASFFENHNVPSKFASK 146 >ref|XP_011094634.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Sesamum indicum] Length = 630 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/99 (36%), Positives = 58/99 (58%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 ++ L+ ++THL+LSNP + +CL FFN L +Q F+ HL+LI RLF R+F Sbjct: 48 VISKLNSRITHLVLSNPRIPASSCLRFFNFLQSNQSIVPQKPDFEAHLTLILRLFGVRRF 107 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 AK +L + + E+ R P S + +++ S +PK+ K Sbjct: 108 AEAKKILNAAVVGENLRRPVSELASVVGGNSVEPKLKTK 146 >ref|XP_011047939.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Populus euphratica] gi|743908947|ref|XP_011047940.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Populus euphratica] gi|743908949|ref|XP_011047941.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Populus euphratica] Length = 617 Score = 73.2 bits (178), Expect = 7e-11 Identities = 36/88 (40%), Positives = 56/88 (63%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 LL LD +T+L+ SNP++ +CL+FFN L K+Q S Q HLS++ RLFK R+F Sbjct: 50 LLSNLDSHITNLVFSNPNVPLHSCLNFFNFLRKNQSFVSHKPDLQSHLSVVFRLFKARRF 109 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQ 34 K +L V++ + RCP + +V+L++ Sbjct: 110 AEMKRVLTYVAMDSNLRCPVANLVSLVE 137 >ref|XP_009614927.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630-like [Nicotiana tomentosiformis] Length = 606 Score = 73.2 bits (178), Expect = 7e-11 Identities = 38/99 (38%), Positives = 58/99 (58%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 L+ L+P+V HL+LSNP + TQ+CL FF L K T + + H++L RL + RKF Sbjct: 42 LMSQLNPQVIHLVLSNPSVPTQSCLSFFKFLQKDLSLTHQRPNLEAHIALALRLLEARKF 101 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 AK++L V+ + R PFS I +L+ + + K+ K Sbjct: 102 AEAKNILYDVAAADGLRKPFSEIASLVGENNVEHKVMGK 140 >ref|XP_010312424.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55840 [Solanum lycopersicum] Length = 1884 Score = 71.2 bits (173), Expect = 2e-10 Identities = 37/95 (38%), Positives = 57/95 (60%) Frame = -2 Query: 285 LDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKFLIAK 106 L+P+VTHL+ SNP + TQ+CL FF L K+Q + + + H++L RLFK RKF AK Sbjct: 1326 LNPQVTHLVFSNPSVPTQSCLSFFKFLQKNQ--SFERPNLESHIALCLRLFKARKFAEAK 1383 Query: 105 DLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 +L +V+ +S R P S + + + + K+ K Sbjct: 1384 SILHTVASDDSLRKPISEVASFLGENHVEHKVMGK 1418 >ref|XP_009771216.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Nicotiana sylvestris] gi|698558141|ref|XP_009771217.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Nicotiana sylvestris] gi|698558145|ref|XP_009771218.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630 [Nicotiana sylvestris] Length = 607 Score = 71.2 bits (173), Expect = 2e-10 Identities = 38/99 (38%), Positives = 56/99 (56%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 L+ L+P+V HL+LSNP + TQ+CL FF L K T + H++L RL + RKF Sbjct: 43 LISQLNPQVIHLVLSNPSVPTQSCLSFFKFLQKDLSFTHQRPNLDSHIALALRLLEARKF 102 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 AK++L V+ + R PFS I +L+ + K+ K Sbjct: 103 AEAKNILYDVAAADGLRKPFSEIASLLGENHVEHKVVGK 141 >ref|XP_002534209.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223525704|gb|EEF28173.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 491 Score = 70.9 bits (172), Expect = 3e-10 Identities = 41/100 (41%), Positives = 61/100 (61%), Gaps = 1/100 (1%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 +L L+P ILSNP CL FFN ++K+Q S Q +L+LI RL + RKF Sbjct: 40 VLSDLNPTKLQQILSNPLHNPLKCLCFFNFIVKNQSLISFEPDLQAYLTLISRLLEARKF 99 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQN-CSQDPKISAK 1 A++LLKSVSI++ R PF ++ + +++ C +PK+ AK Sbjct: 100 SDAENLLKSVSIEDYHRYPFPLLASTIEHCCCLEPKVIAK 139 >ref|XP_012064747.1| PREDICTED: pentatricopeptide repeat-containing protein At2g28050 [Jatropha curcas] Length = 458 Score = 70.1 bits (170), Expect = 6e-10 Identities = 40/100 (40%), Positives = 59/100 (59%), Gaps = 1/100 (1%) Frame = -2 Query: 297 LLPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKF 118 +L L+P H LS+P LK CL F+ L +++ S Q HL LI +L K R+F Sbjct: 44 ILSNLNPTKLHQTLSDPDLKPLYCLHLFDFLRQNESLISFQPDLQAHLILISKLTKGRRF 103 Query: 117 LIAKDLLKSVSIQESPRCPFSVIVTLMQN-CSQDPKISAK 1 A+ LLKSVSI++ R PFS++ + ++N C +P + AK Sbjct: 104 SDAEILLKSVSIKDCNRYPFSILASTIENCCCFEPNVIAK 143 >ref|XP_010109469.1| hypothetical protein L484_007489 [Morus notabilis] gi|587936027|gb|EXC22880.1| hypothetical protein L484_007489 [Morus notabilis] Length = 134 Score = 68.9 bits (167), Expect = 1e-09 Identities = 37/84 (44%), Positives = 52/84 (61%) Frame = -2 Query: 294 LPTLDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKFL 115 L LD HLILS+P++++ C FFN L+K++ S Q HL+LI RL K R F Sbjct: 49 LSHLDLNSLHLILSDPNVRSSVCFKFFNFLVKNRSFVSVKPDLQAHLTLISRLLKSRNFS 108 Query: 114 IAKDLLKSVSIQESPRCPFSVIVT 43 A++LL+SVS+ E+ PF VI + Sbjct: 109 QAENLLRSVSVGENCDYPFPVIAS 132 >ref|XP_006339300.1| PREDICTED: pentatricopeptide repeat-containing protein At2g32630-like [Solanum tuberosum] Length = 1090 Score = 68.9 bits (167), Expect = 1e-09 Identities = 37/95 (38%), Positives = 55/95 (57%) Frame = -2 Query: 285 LDPKVTHLILSNPHLKTQTCLDFFNLLLKSQPPTSSNHHFQPHLSLICRLFKDRKFLIAK 106 L+P+VTHL+ NP + TQ+CL FF L K+Q + + + H++L RLFK RKF AK Sbjct: 532 LNPQVTHLVFLNPSVPTQSCLSFFKFLQKNQ--SFERPNLESHIALFLRLFKARKFAEAK 589 Query: 105 DLLKSVSIQESPRCPFSVIVTLMQNCSQDPKISAK 1 +L +V+ +S R P I + + D K+ K Sbjct: 590 SILHTVASDDSLRKPILEIASFLGENHVDHKVMGK 624