BLASTX nr result
ID: Cinnamomum25_contig00020477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00020477 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16010.3| unnamed protein product [Vitis vinifera] 43 7e-08 ref|XP_012471219.1| PREDICTED: serine/arginine-rich splicing fac... 56 8e-06 >emb|CBI16010.3| unnamed protein product [Vitis vinifera] Length = 198 Score = 43.1 bits (100), Expect(2) = 7e-08 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 325 RCIKYLDRSVLEGRVITVEK 266 RCIKYLDRSVLEGRVITVEK Sbjct: 105 RCIKYLDRSVLEGRVITVEK 124 Score = 40.0 bits (92), Expect(2) = 7e-08 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -2 Query: 267 RVAVCSSSSPNFKSLTTTNQSQIKLPQANIRL 172 +VAVCSSSSP+FKSLTT +Q QANIRL Sbjct: 124 KVAVCSSSSPDFKSLTTKPSNQTH--QANIRL 153 >ref|XP_012471219.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform X2 [Gossypium raimondii] Length = 138 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/40 (77%), Positives = 32/40 (80%), Gaps = 5/40 (12%) Frame = -1 Query: 325 RCIKYLDRSVLEGRVITVEK-----GSCV*QLFTKLQKPY 221 RCIKYL+RSVLEGRVITVEK SCV QLFTKLQK Y Sbjct: 98 RCIKYLNRSVLEGRVITVEKFLWQQVSCVLQLFTKLQKSY 137