BLASTX nr result
ID: Cinnamomum25_contig00019243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00019243 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU14900.1| unknown [Glycine max] 58 2e-06 >gb|ACU14900.1| unknown [Glycine max] Length = 70 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = -1 Query: 148 GAP*PRNGLPLEGET*MVSLSLWNPCLNTPNPNSKPIKTTTRIKHV 11 G P P P E + VSL LWNPCLNTPNPN+ P+ TTR KHV Sbjct: 3 GLPPPAAPPPQESQKLTVSLILWNPCLNTPNPNNNPMAITTRTKHV 48