BLASTX nr result
ID: Cinnamomum25_contig00018908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00018908 (520 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444360.1| hypothetical protein CICLE_v10022836mg [Citr... 61 3e-07 gb|KDO87204.1| hypothetical protein CISIN_1g032960mg [Citrus sin... 60 4e-07 ref|XP_010259538.1| PREDICTED: outer envelope pore protein 16-4,... 60 7e-07 ref|XP_007050933.1| Mitochondrial import inner membrane transloc... 59 1e-06 ref|XP_011033530.1| PREDICTED: outer envelope pore protein 16-4,... 57 4e-06 ref|XP_011033528.1| PREDICTED: outer envelope pore protein 16-4,... 57 4e-06 ref|XP_008451566.1| PREDICTED: outer envelope pore protein 16-4,... 57 4e-06 ref|XP_002320341.1| mitochondrial import inner membrane transloc... 57 4e-06 ref|XP_010069909.1| PREDICTED: outer envelope pore protein 16-4,... 57 5e-06 ref|XP_002523089.1| protein translocase, putative [Ricinus commu... 57 6e-06 ref|XP_004136026.1| PREDICTED: outer envelope pore protein 16-4,... 56 8e-06 >ref|XP_006444360.1| hypothetical protein CICLE_v10022836mg [Citrus clementina] gi|568852616|ref|XP_006479968.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic-like isoform X1 [Citrus sinensis] gi|568852618|ref|XP_006479969.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic-like isoform X2 [Citrus sinensis] gi|557546622|gb|ESR57600.1| hypothetical protein CICLE_v10022836mg [Citrus clementina] gi|641868518|gb|KDO87202.1| hypothetical protein CISIN_1g032960mg [Citrus sinensis] Length = 130 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/77 (38%), Positives = 36/77 (46%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDWXXXXXXXXXXXXXXXXXXXNWMQXXXX 337 KS+GKYG QCGL AGVF++TRCG++RYR + DW W Q Sbjct: 54 KSIGKYGFQCGLVAGVFSSTRCGIQRYRKQNDWVNALIAGAVTGAAIAAGTRRWTQVIGV 113 Query: 336 XXXXXXXXXXADYSTAN 286 ADYS N Sbjct: 114 AGIVSAFSAAADYSRTN 130 >gb|KDO87204.1| hypothetical protein CISIN_1g032960mg [Citrus sinensis] gi|641868521|gb|KDO87205.1| hypothetical protein CISIN_1g032960mg [Citrus sinensis] gi|641868522|gb|KDO87206.1| hypothetical protein CISIN_1g032960mg [Citrus sinensis] Length = 88 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 KS+GKYG QCGL AGVF++TRCG++RYR + DW Sbjct: 54 KSIGKYGFQCGLVAGVFSSTRCGIQRYRKQNDW 86 >ref|XP_010259538.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic [Nelumbo nucifera] gi|720011367|ref|XP_010259539.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic [Nelumbo nucifera] gi|720011370|ref|XP_010259540.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic [Nelumbo nucifera] Length = 130 Score = 59.7 bits (143), Expect = 7e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -2 Query: 519 VKSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 VKS G +GLQCGLFAG+F+ TRCGV+++R +KDW Sbjct: 53 VKSAGTFGLQCGLFAGIFSTTRCGVQKFRKKKDW 86 >ref|XP_007050933.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Theobroma cacao] gi|508703194|gb|EOX95090.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Theobroma cacao] Length = 133 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 KSVGK+G QCGL AGVFT TRCG++RYR + DW Sbjct: 54 KSVGKFGFQCGLVAGVFTMTRCGLQRYRRQNDW 86 >ref|XP_011033530.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic isoform X2 [Populus euphratica] gi|743870274|ref|XP_011033531.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic isoform X3 [Populus euphratica] Length = 126 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 K++GK+G QCGL AGVFTAT CG++RYR + DW Sbjct: 54 KTIGKFGFQCGLVAGVFTATCCGIQRYRRQNDW 86 >ref|XP_011033528.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic isoform X1 [Populus euphratica] gi|743870266|ref|XP_011033529.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic isoform X1 [Populus euphratica] Length = 130 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 K++GK+G QCGL AGVFTAT CG++RYR + DW Sbjct: 54 KTIGKFGFQCGLVAGVFTATCCGIQRYRRQNDW 86 >ref|XP_008451566.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic [Cucumis melo] Length = 130 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 KSVGKYG QCGL AG FT T CG++RYR DW Sbjct: 54 KSVGKYGFQCGLVAGTFTLTHCGIQRYRRRNDW 86 >ref|XP_002320341.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Populus trichocarpa] gi|222861114|gb|EEE98656.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein [Populus trichocarpa] Length = 130 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 K++GK+G QCGL AGVFTAT CG++RYR + DW Sbjct: 54 KTIGKFGFQCGLVAGVFTATCCGIQRYRRQNDW 86 >ref|XP_010069909.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic [Eucalyptus grandis] gi|629092431|gb|KCW58426.1| hypothetical protein EUGRSUZ_H01109 [Eucalyptus grandis] Length = 130 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 KSVGK+ QCGL AGVFT TRCG++RYR DW Sbjct: 54 KSVGKFSFQCGLVAGVFTVTRCGIQRYRRRDDW 86 >ref|XP_002523089.1| protein translocase, putative [Ricinus communis] gi|223537651|gb|EEF39274.1| protein translocase, putative [Ricinus communis] Length = 130 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 KSVGK+ QCGL AGVFT T CG+RRYR + DW Sbjct: 54 KSVGKFSFQCGLVAGVFTFTHCGIRRYRRKNDW 86 >ref|XP_004136026.1| PREDICTED: outer envelope pore protein 16-4, chloroplastic [Cucumis sativus] gi|700189709|gb|KGN44942.1| hypothetical protein Csa_7G397550 [Cucumis sativus] Length = 130 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = -2 Query: 516 KSVGKYGLQCGLFAGVFTATRCGVRRYRMEKDW 418 +SVGKYG QCGL AG FT T CG++RYR DW Sbjct: 54 RSVGKYGFQCGLVAGTFTLTHCGIQRYRKRNDW 86