BLASTX nr result
ID: Cinnamomum25_contig00018763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00018763 (553 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010248756.1| PREDICTED: uncharacterized protein LOC104591... 59 2e-06 ref|XP_011024109.1| PREDICTED: programmed cell death protein 4 [... 57 4e-06 ref|XP_006476941.1| PREDICTED: uncharacterized protein LOC102613... 57 4e-06 ref|XP_004236308.1| PREDICTED: uncharacterized protein LOC101255... 57 4e-06 ref|XP_008439152.1| PREDICTED: programmed cell death protein 4-l... 56 9e-06 gb|KDO69396.1| hypothetical protein CISIN_1g005187mg [Citrus sin... 56 9e-06 gb|KDO69394.1| hypothetical protein CISIN_1g005187mg [Citrus sin... 56 9e-06 ref|XP_006351447.1| PREDICTED: uncharacterized protein LOC102604... 56 9e-06 ref|XP_006439997.1| hypothetical protein CICLE_v10019069mg [Citr... 56 9e-06 >ref|XP_010248756.1| PREDICTED: uncharacterized protein LOC104591570 [Nelumbo nucifera] Length = 713 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFG-SGI 458 ALDIPNAGEKF FYVEHA++NGWLLP+F SG+ Sbjct: 668 ALDIPNAGEKFRFYVEHAKRNGWLLPSFALSGV 700 >ref|XP_011024109.1| PREDICTED: programmed cell death protein 4 [Populus euphratica] Length = 713 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGSGIG 455 ALDIPNA EKF FYVEHA+K GWLL +FGS +G Sbjct: 671 ALDIPNAEEKFNFYVEHAQKKGWLLASFGSSVG 703 >ref|XP_006476941.1| PREDICTED: uncharacterized protein LOC102613560 [Citrus sinensis] Length = 710 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGSGI 458 ALDIPNA EKF FYVE+ARK GWLLP FGS + Sbjct: 668 ALDIPNAKEKFTFYVEYARKKGWLLPAFGSSV 699 >ref|XP_004236308.1| PREDICTED: uncharacterized protein LOC101255979 [Solanum lycopersicum] Length = 715 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGS 464 ALDIPNA +KFMFYVEHA+ NGW+LP+FGS Sbjct: 682 ALDIPNAKDKFMFYVEHAKGNGWVLPSFGS 711 >ref|XP_008439152.1| PREDICTED: programmed cell death protein 4-like [Cucumis melo] gi|659067381|ref|XP_008439160.1| PREDICTED: programmed cell death protein 4-like [Cucumis melo] gi|659067383|ref|XP_008439168.1| PREDICTED: programmed cell death protein 4-like [Cucumis melo] gi|659067385|ref|XP_008439175.1| PREDICTED: programmed cell death protein 4-like [Cucumis melo] Length = 709 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGSGIG 455 ALDIPNA +KF+ YVEHA+K GWLLP+FGS G Sbjct: 668 ALDIPNASKKFISYVEHAQKKGWLLPSFGSSAG 700 >gb|KDO69396.1| hypothetical protein CISIN_1g005187mg [Citrus sinensis] gi|641850525|gb|KDO69397.1| hypothetical protein CISIN_1g005187mg [Citrus sinensis] gi|641850526|gb|KDO69398.1| hypothetical protein CISIN_1g005187mg [Citrus sinensis] Length = 640 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGS 464 ALDIPNA EKF FYVE+ARK GWLLP FGS Sbjct: 598 ALDIPNAKEKFTFYVEYARKKGWLLPAFGS 627 >gb|KDO69394.1| hypothetical protein CISIN_1g005187mg [Citrus sinensis] gi|641850523|gb|KDO69395.1| hypothetical protein CISIN_1g005187mg [Citrus sinensis] Length = 710 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGS 464 ALDIPNA EKF FYVE+ARK GWLLP FGS Sbjct: 668 ALDIPNAKEKFTFYVEYARKKGWLLPAFGS 697 >ref|XP_006351447.1| PREDICTED: uncharacterized protein LOC102604303 [Solanum tuberosum] Length = 715 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGS 464 ALDIPNA +KF FYVEHA+ NGWLLP+FGS Sbjct: 682 ALDIPNAKDKFTFYVEHAKGNGWLLPSFGS 711 >ref|XP_006439997.1| hypothetical protein CICLE_v10019069mg [Citrus clementina] gi|567895020|ref|XP_006439998.1| hypothetical protein CICLE_v10019069mg [Citrus clementina] gi|557542259|gb|ESR53237.1| hypothetical protein CICLE_v10019069mg [Citrus clementina] gi|557542260|gb|ESR53238.1| hypothetical protein CICLE_v10019069mg [Citrus clementina] Length = 710 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -1 Query: 553 ALDIPNAGEKFMFYVEHARKNGWLLPTFGS 464 ALDIPNA EKF FYVE+ARK GWLLP FGS Sbjct: 668 ALDIPNAKEKFTFYVEYARKKGWLLPAFGS 697