BLASTX nr result
ID: Cinnamomum25_contig00018251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00018251 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010943747.1| PREDICTED: mitochondrial import inner membra... 94 4e-17 ref|XP_009402168.1| PREDICTED: mitochondrial import inner membra... 94 5e-17 ref|XP_010026220.1| PREDICTED: mitochondrial import inner membra... 93 8e-17 ref|XP_008790726.1| PREDICTED: mitochondrial import inner membra... 92 1e-16 ref|XP_010250594.1| PREDICTED: mitochondrial import inner membra... 92 1e-16 ref|XP_002284270.1| PREDICTED: mitochondrial import inner membra... 92 2e-16 ref|XP_010926768.1| PREDICTED: mitochondrial import inner membra... 90 7e-16 gb|ADW66158.1| mitochondrial import inner membrane translocase s... 90 7e-16 emb|CDP14990.1| unnamed protein product [Coffea canephora] 89 9e-16 ref|XP_011073110.1| PREDICTED: mitochondrial import inner membra... 88 2e-15 ref|XP_009342209.1| PREDICTED: mitochondrial import inner membra... 88 2e-15 ref|XP_008813226.1| PREDICTED: mitochondrial import inner membra... 88 2e-15 ref|XP_002511123.1| translocase of inner mitochondrial membrane,... 88 2e-15 ref|XP_012830546.1| PREDICTED: mitochondrial import inner membra... 88 2e-15 ref|XP_004501728.1| PREDICTED: mitochondrial import inner membra... 88 2e-15 ref|XP_012090628.1| PREDICTED: mitochondrial import inner membra... 88 3e-15 ref|XP_006347349.1| PREDICTED: mitochondrial import inner membra... 88 3e-15 ref|XP_007038081.1| Translocase inner membrane subunit 8 [Theobr... 88 3e-15 ref|XP_011083437.1| PREDICTED: mitochondrial import inner membra... 87 4e-15 ref|XP_010678289.1| PREDICTED: mitochondrial import inner membra... 87 4e-15 >ref|XP_010943747.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Elaeis guineensis] Length = 74 Score = 94.0 bits (232), Expect = 4e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ESTCLTNCAQRYMDMS++IMKRFQSMQ Sbjct: 31 CWDKCITGTPGSKFSSSESTCLTNCAQRYMDMSILIMKRFQSMQ 74 >ref|XP_009402168.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Musa acuminata subsp. malaccensis] Length = 74 Score = 93.6 bits (231), Expect = 5e-17 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ESTCLTNCAQRYMDMS++IMKRFQSMQ Sbjct: 31 CWDKCITGTPGSKFSSSESTCLTNCAQRYMDMSMMIMKRFQSMQ 74 >ref|XP_010026220.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Eucalyptus grandis] gi|629118629|gb|KCW83119.1| hypothetical protein EUGRSUZ_B00077 [Eucalyptus grandis] Length = 78 Score = 92.8 bits (229), Expect = 8e-17 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ESTCL NCAQRYMDMS+IIMKRFQSMQ Sbjct: 35 CWDKCITGTPGSKFSSSESTCLANCAQRYMDMSIIIMKRFQSMQ 78 >ref|XP_008790726.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Phoenix dactylifera] Length = 74 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ESTCLTNCAQRYMDM+++IMKRFQSMQ Sbjct: 31 CWDKCITGTPGSKFSSSESTCLTNCAQRYMDMTVLIMKRFQSMQ 74 >ref|XP_010250594.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Nelumbo nucifera] Length = 78 Score = 92.0 bits (227), Expect = 1e-16 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSM 204 CWDKCITGTPGSKFSS ESTCL+NCAQRYMDMSLIIMKRFQSM Sbjct: 35 CWDKCITGTPGSKFSSSESTCLSNCAQRYMDMSLIIMKRFQSM 77 >ref|XP_002284270.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Vitis vinifera] gi|297734470|emb|CBI15717.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCIT TPGSKFSS ESTCL+NCAQRYMDMSLIIMKRFQSMQ Sbjct: 34 CWDKCITSTPGSKFSSSESTCLSNCAQRYMDMSLIIMKRFQSMQ 77 >ref|XP_010926768.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Elaeis guineensis] Length = 74 Score = 89.7 bits (221), Expect = 7e-16 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCIT TPGSKFSS ESTCLTNCAQRY+DMS++IMKRFQSMQ Sbjct: 31 CWDKCITSTPGSKFSSSESTCLTNCAQRYVDMSVLIMKRFQSMQ 74 >gb|ADW66158.1| mitochondrial import inner membrane translocase subunit [Solanum nigrum] Length = 78 Score = 89.7 bits (221), Expect = 7e-16 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ES+CLTNCAQRYM+MSLII+KRFQ+MQ Sbjct: 35 CWDKCITGTPGSKFSSSESSCLTNCAQRYMEMSLIIVKRFQNMQ 78 >emb|CDP14990.1| unnamed protein product [Coffea canephora] Length = 78 Score = 89.4 bits (220), Expect = 9e-16 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSM 204 CWDKCIT TPGSKFSS E+TCLTNCAQRYMDMS+IIMKRFQSM Sbjct: 35 CWDKCITSTPGSKFSSSETTCLTNCAQRYMDMSMIIMKRFQSM 77 >ref|XP_011073110.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Sesamum indicum] Length = 78 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQ 210 CWDKCITGTPGSKFSS ES CLTNCAQRYMDMSLIIMKRFQ Sbjct: 35 CWDKCITGTPGSKFSSSESNCLTNCAQRYMDMSLIIMKRFQ 75 >ref|XP_009342209.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Pyrus x bretschneideri] gi|694429370|ref|XP_009342212.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Pyrus x bretschneideri] gi|694442286|ref|XP_009347837.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Pyrus x bretschneideri] Length = 78 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ES CL NCA+RY+DMS+IIMKRFQSMQ Sbjct: 35 CWDKCITGTPGSKFSSSESACLANCARRYLDMSMIIMKRFQSMQ 78 >ref|XP_008813226.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Phoenix dactylifera] Length = 74 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCIT TPGSKFSS ESTCLTNCAQRY++MS++IMKRFQSMQ Sbjct: 31 CWDKCITSTPGSKFSSSESTCLTNCAQRYVEMSVLIMKRFQSMQ 74 >ref|XP_002511123.1| translocase of inner mitochondrial membrane, putative [Ricinus communis] gi|223550238|gb|EEF51725.1| translocase of inner mitochondrial membrane, putative [Ricinus communis] Length = 78 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSM 204 CWDKCIT TPGSKFSS ES+CLTNC QRYMDMSLIIMKRFQSM Sbjct: 35 CWDKCITSTPGSKFSSSESSCLTNCTQRYMDMSLIIMKRFQSM 77 >ref|XP_012830546.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Erythranthe guttatus] gi|604344242|gb|EYU43024.1| hypothetical protein MIMGU_mgv1a017418mg [Erythranthe guttata] Length = 76 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQ 210 CWDKCITGTPGSKFSSGE+TCLTNCAQRYMDMSL+IMKR Q Sbjct: 35 CWDKCITGTPGSKFSSGETTCLTNCAQRYMDMSLLIMKRLQ 75 >ref|XP_004501728.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Cicer arietinum] Length = 78 Score = 88.2 bits (217), Expect = 2e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPG+KFSS E+ CLTNCAQRYM+MS++IMKRFQSMQ Sbjct: 35 CWDKCITGTPGNKFSSSETNCLTNCAQRYMEMSMLIMKRFQSMQ 78 >ref|XP_012090628.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Jatropha curcas] gi|282848242|gb|ADB02902.1| mitochondrial import inner membrane translocase subunit Tim8/small zinc finger-like protein [Jatropha curcas] gi|643706437|gb|KDP22569.1| hypothetical protein JCGZ_26400 [Jatropha curcas] Length = 78 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSM 204 CWDKCIT TPGSKFSS ES CL+NCAQRYMDMSLIIMKRFQSM Sbjct: 35 CWDKCITSTPGSKFSSSESACLSNCAQRYMDMSLIIMKRFQSM 77 >ref|XP_006347349.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Solanum tuberosum] Length = 78 Score = 87.8 bits (216), Expect = 3e-15 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCITGTPGSKFSS ES CL+NCAQRYM+MSL+I+KRFQSMQ Sbjct: 35 CWDKCITGTPGSKFSSSESNCLSNCAQRYMEMSLMIVKRFQSMQ 78 >ref|XP_007038081.1| Translocase inner membrane subunit 8 [Theobroma cacao] gi|508775326|gb|EOY22582.1| Translocase inner membrane subunit 8 [Theobroma cacao] Length = 185 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCIT TPGSKFSS ES CL++CAQRYMDMSLIIMKRFQSMQ Sbjct: 142 CWDKCITSTPGSKFSSSESACLSHCAQRYMDMSLIIMKRFQSMQ 185 >ref|XP_011083437.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8-like [Sesamum indicum] Length = 77 Score = 87.0 bits (214), Expect = 4e-15 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQ 210 CWDKCITGTPGSKFSS ESTCLTNCAQRYMDMSL+IMKR Q Sbjct: 35 CWDKCITGTPGSKFSSSESTCLTNCAQRYMDMSLLIMKRLQ 75 >ref|XP_010678289.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Beta vulgaris subsp. vulgaris] gi|870859528|gb|KMT10961.1| hypothetical protein BVRB_5g112940 [Beta vulgaris subsp. vulgaris] Length = 78 Score = 87.0 bits (214), Expect = 4e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -2 Query: 332 CWDKCITGTPGSKFSSGESTCLTNCAQRYMDMSLIIMKRFQSMQ 201 CWDKCIT TPGSKFSS E+TCL NCAQRY+DMS++IMKRFQSMQ Sbjct: 35 CWDKCITSTPGSKFSSSEATCLNNCAQRYLDMSVLIMKRFQSMQ 78