BLASTX nr result
ID: Cinnamomum25_contig00018186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00018186 (251 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010241042.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 >ref|XP_010241042.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Nelumbo nucifera] Length = 380 Score = 64.7 bits (156), Expect = 2e-08 Identities = 36/63 (57%), Positives = 43/63 (68%) Frame = -2 Query: 247 KKGDSAFAVKLCKVSINGKWSIDVSLLQGVVDALVKESSKEEAQKLVEFAASKTYRYSSL 68 +K D A KLCK S+N + +D LLQ VVD LVKES E+A+KLVE SK+Y SSL Sbjct: 318 EKEDFGLAFKLCKESLN-RCRVDAGLLQVVVDGLVKESKVEDAKKLVELGRSKSYSRSSL 376 Query: 67 KMP 59 KMP Sbjct: 377 KMP 379