BLASTX nr result
ID: Cinnamomum25_contig00018163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00018163 (707 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010262231.1| PREDICTED: leucine-rich repeat extensin-like... 64 6e-08 ref|XP_008228201.1| PREDICTED: leucine-rich repeat extensin-like... 58 3e-07 ref|XP_009372413.1| PREDICTED: branchpoint-bridging protein [Pyr... 53 3e-07 ref|XP_002304137.1| proline-rich family protein [Populus trichoc... 49 5e-07 ref|XP_002521331.1| actin binding protein, putative [Ricinus com... 52 9e-06 >ref|XP_010262231.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nelumbo nucifera] Length = 226 Score = 64.3 bits (155), Expect = 6e-08 Identities = 26/45 (57%), Positives = 39/45 (86%) Frame = -1 Query: 380 SKQPTRKVNLGRKIGLVFVGMAGLMQVAVVGFLGFRRWQISNIKE 246 +K P + +N+G+KIGL+F G+AG++QVAVVGF+ F+RWQ+S IK+ Sbjct: 178 TKPPDQTINIGKKIGLLFAGVAGVLQVAVVGFIVFKRWQVSKIKD 222 >ref|XP_008228201.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Prunus mume] Length = 189 Score = 58.2 bits (139), Expect(2) = 3e-07 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -1 Query: 407 SKTRTTHPGSKQPTRKVNLGRKIGLVFVGMAGLMQVAVVGFLGFRRWQISNIKE 246 + R HP P K N G+KIGL+FVGMA ++Q+ V+GFL F+R Q+ +K+ Sbjct: 130 TNNRRPHPPPPHPGHKYNAGKKIGLLFVGMAAILQIGVIGFLVFKRRQLLRVKD 183 Score = 23.9 bits (50), Expect(2) = 3e-07 Identities = 23/71 (32%), Positives = 27/71 (38%), Gaps = 16/71 (22%) Frame = -2 Query: 673 IFPTPPPTLSSKCP----P*P*RF*SQPSL-------WSNLPSPL-----IPPRRPGIGT 542 ++P PPP LS P P P + PS SN PSPL PP RP Sbjct: 51 LWPPPPPPLSPSPPQSPTPPPPESPTPPSPNSPSRPDSSNSPSPLESPGPPPPARPANQL 110 Query: 541 GQATPRTTHPP 509 + PP Sbjct: 111 NSKNDQKRLPP 121 >ref|XP_009372413.1| PREDICTED: branchpoint-bridging protein [Pyrus x bretschneideri] Length = 181 Score = 53.1 bits (126), Expect(2) = 3e-07 Identities = 24/51 (47%), Positives = 34/51 (66%) Frame = -1 Query: 398 RTTHPGSKQPTRKVNLGRKIGLVFVGMAGLMQVAVVGFLGFRRWQISNIKE 246 R HP Q K N G+KIGL+FVG A ++Q+ V+GFL F+R Q+ +K+ Sbjct: 125 RREHPLPPQRGHKYNAGKKIGLLFVGTASILQIGVIGFLVFKRRQLLKVKD 175 Score = 28.9 bits (63), Expect(2) = 3e-07 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -2 Query: 664 TPPPTLSSKCPP*P*RF*SQPSLWSNLPSPLIPPRRPG-IGTGQATPRTTHPP 509 +PPP S PP P P++ S SPL P R P I + + R PP Sbjct: 63 SPPPPESPTPPPNPPPLPESPNMPSPSESPLPPDRPPNQISSNNDSKRPPPPP 115 >ref|XP_002304137.1| proline-rich family protein [Populus trichocarpa] gi|222841569|gb|EEE79116.1| proline-rich family protein [Populus trichocarpa] Length = 167 Score = 49.3 bits (116), Expect(2) = 5e-07 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = -1 Query: 398 RTTHPGSKQP----TRKVNLGRKIGLVFVGMAGLMQVAVVGFLGFRRWQISNIKE 246 R +HP P ++N G+KIGL+FVG+A ++Q+ VVGFL ++R Q+ I + Sbjct: 106 RRSHPPPPPPPPSKNHQMNSGKKIGLLFVGIAAILQIGVVGFLAYKRRQLLKIND 160 Score = 32.0 bits (71), Expect(2) = 5e-07 Identities = 23/53 (43%), Positives = 24/53 (45%) Frame = -2 Query: 667 PTPPPTLSSKCPP*P*RF*SQPSLWSNLPSPLIPPRRPGIGTGQATPRTTHPP 509 P PPP SK PP P R QP P P PPR TG R +HPP Sbjct: 69 PPPPPPPPSKSPPPPPRKKLQP------PPP--PPR--DRSTGNVMRRRSHPP 111 >ref|XP_002521331.1| actin binding protein, putative [Ricinus communis] gi|223539409|gb|EEF40999.1| actin binding protein, putative [Ricinus communis] Length = 210 Score = 52.0 bits (123), Expect(2) = 9e-06 Identities = 23/53 (43%), Positives = 35/53 (66%) Frame = -1 Query: 407 SKTRTTHPGSKQPTRKVNLGRKIGLVFVGMAGLMQVAVVGFLGFRRWQISNIK 249 S TR P K +N G+KIGL+FVG+A ++Q+ V+GFL F+R Q+ ++ Sbjct: 150 SWTRHNRPPPKNSNHSMNTGKKIGLLFVGIAAILQIGVIGFLVFKRKQLLRVQ 202 Score = 25.0 bits (53), Expect(2) = 9e-06 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -2 Query: 667 PTPPPTLSSKCPP*P*RF*SQP---SLWSNLPSPLIPPRRPGIGTGQATPRTTHPPS 506 P+PPP PP P S P S S+L SP P P + P PPS Sbjct: 54 PSPPPPSPPPPPPPPPPSPSPPPPTSPPSSLLSPPPPSPPPPASSSSPPPPPPPPPS 110