BLASTX nr result
ID: Cinnamomum25_contig00017117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00017117 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 73 6e-11 ref|XP_012075616.1| PREDICTED: WPP domain-associated protein-lik... 73 8e-11 ref|XP_012075755.1| PREDICTED: WPP domain-associated protein-lik... 71 2e-10 emb|CDP17300.1| unnamed protein product [Coffea canephora] 70 7e-10 emb|CBI31022.3| unnamed protein product [Vitis vinifera] 69 2e-09 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein [Vi... 69 2e-09 ref|XP_010056982.1| PREDICTED: WPP domain-associated protein-lik... 68 2e-09 ref|XP_006845998.1| PREDICTED: WPP domain-associated protein [Am... 68 2e-09 ref|XP_010923691.1| PREDICTED: WPP domain-associated protein-lik... 67 3e-09 ref|XP_008794443.1| PREDICTED: WPP domain-associated protein iso... 67 5e-09 ref|XP_012569941.1| PREDICTED: WPP domain-associated protein iso... 67 6e-09 ref|XP_008796779.1| PREDICTED: LOW QUALITY PROTEIN: WPP domain-a... 67 6e-09 ref|XP_004486461.1| PREDICTED: WPP domain-associated protein iso... 67 6e-09 ref|XP_010907331.1| PREDICTED: WPP domain-associated protein-lik... 66 8e-09 ref|XP_010316952.1| PREDICTED: WPP domain-associated protein [So... 66 8e-09 ref|XP_009800226.1| PREDICTED: WPP domain-associated protein [Ni... 66 8e-09 ref|NP_001067257.1| Os12g0612300 [Oryza sativa Japonica Group] g... 66 8e-09 ref|XP_012830201.1| PREDICTED: WPP domain-associated protein [Er... 66 1e-08 ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-lik... 66 1e-08 ref|XP_009598621.1| PREDICTED: WPP domain-associated protein-lik... 65 1e-08 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 73.2 bits (178), Expect = 6e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VD L SLL KIY+ LDHYSPIL HYPGIME L+L+RR + GE+VKPV Sbjct: 857 VDTLLSLLEKIYIALDHYSPILQHYPGIMEVLKLVRRELSGESVKPV 903 >ref|XP_012075616.1| PREDICTED: WPP domain-associated protein-like [Jatropha curcas] Length = 883 Score = 72.8 bits (177), Expect = 8e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VD L SLL KIY+ LDHYSPIL HYPGIME L+L+RR + GE+VKPV Sbjct: 837 VDTLLSLLEKIYIALDHYSPILKHYPGIMEILKLVRRELSGESVKPV 883 >ref|XP_012075755.1| PREDICTED: WPP domain-associated protein-like [Jatropha curcas] Length = 819 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKP 120 VD L SLL KIY+ LDHYSPIL HYPGIME L+L+RR + GE+VKP Sbjct: 773 VDTLLSLLEKIYIALDHYSPILKHYPGIMEILKLVRRELSGESVKP 818 >emb|CDP17300.1| unnamed protein product [Coffea canephora] Length = 876 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVK 123 VD L +LL KIY+GLDHYSP+L HYPG+METL+LIRR + GE++K Sbjct: 825 VDKLLNLLEKIYIGLDHYSPVLRHYPGVMETLKLIRRELTGESMK 869 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VDAL SLL KIY+ LDHYSPIL HYPG++E L+L+RR + E+ KPV Sbjct: 761 VDALLSLLEKIYIALDHYSPILQHYPGVIEILKLVRRELSAESTKPV 807 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] gi|731405355|ref|XP_010655749.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] gi|731405357|ref|XP_010655750.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] gi|731405359|ref|XP_010655751.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] Length = 902 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VDAL SLL KIY+ LDHYSPIL HYPG++E L+L+RR + E+ KPV Sbjct: 856 VDALLSLLEKIYIALDHYSPILQHYPGVIEILKLVRRELSAESTKPV 902 >ref|XP_010056982.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Eucalyptus grandis] gi|702345207|ref|XP_010056983.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Eucalyptus grandis] gi|702345212|ref|XP_010056984.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Eucalyptus grandis] gi|629108772|gb|KCW73918.1| hypothetical protein EUGRSUZ_E02503 [Eucalyptus grandis] gi|629108773|gb|KCW73919.1| hypothetical protein EUGRSUZ_E02503 [Eucalyptus grandis] Length = 897 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVK 123 VD L +LL K+Y+GLDHYSPIL HYPGIME L+L+RR + GE++K Sbjct: 851 VDTLLNLLEKVYIGLDHYSPILQHYPGIMEVLKLVRRELTGESLK 895 >ref|XP_006845998.1| PREDICTED: WPP domain-associated protein [Amborella trichopoda] gi|548848754|gb|ERN07673.1| hypothetical protein AMTR_s00155p00053970 [Amborella trichopoda] Length = 907 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VD L SLL KIY+ LDHYSPIL HYPGIME L+LI+R ++GE +P+ Sbjct: 861 VDTLLSLLEKIYIALDHYSPILQHYPGIMEILKLIQRELKGEVAQPI 907 >ref|XP_010923691.1| PREDICTED: WPP domain-associated protein-like [Elaeis guineensis] Length = 877 Score = 67.4 bits (163), Expect = 3e-09 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETV 126 VDAL LLGKIY+ LDHYSPIL HYPG+ME L+L++R ++GE + Sbjct: 831 VDALLGLLGKIYIALDHYSPILQHYPGVMEILKLVQRELKGENI 874 >ref|XP_008794443.1| PREDICTED: WPP domain-associated protein isoform X2 [Phoenix dactylifera] Length = 874 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETV 126 VDAL LLGKIY+ LDHYSP+L HYPG+ME L+L++R ++GE + Sbjct: 831 VDALLGLLGKIYIALDHYSPVLQHYPGVMEILKLVQRELKGENI 874 >ref|XP_012569941.1| PREDICTED: WPP domain-associated protein isoform X2 [Cicer arietinum] Length = 819 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VD L LLGKIY+ LDHYSPIL HYPGI+E LEL+RR + G++ K + Sbjct: 773 VDTLLRLLGKIYVALDHYSPILQHYPGIIEVLELVRRELSGDSRKHI 819 >ref|XP_008796779.1| PREDICTED: LOW QUALITY PROTEIN: WPP domain-associated protein-like [Phoenix dactylifera] Length = 877 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETV 126 VDAL LLGKIY+ LDHYSP+L HYPG+ME L+L++R ++GE + Sbjct: 834 VDALLGLLGKIYVALDHYSPVLQHYPGVMEILKLVQRELKGEDI 877 >ref|XP_004486461.1| PREDICTED: WPP domain-associated protein isoform X1 [Cicer arietinum] Length = 857 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VD L LLGKIY+ LDHYSPIL HYPGI+E LEL+RR + G++ K + Sbjct: 811 VDTLLRLLGKIYVALDHYSPILQHYPGIIEVLELVRRELSGDSRKHI 857 >ref|XP_010907331.1| PREDICTED: WPP domain-associated protein-like [Elaeis guineensis] Length = 877 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETV 126 VDAL LLGKIY+ LDHYSP+L HYPG+ME L L++R ++GE + Sbjct: 834 VDALLGLLGKIYVALDHYSPVLQHYPGVMEILNLVQRELKGEDI 877 >ref|XP_010316952.1| PREDICTED: WPP domain-associated protein [Solanum lycopersicum] Length = 897 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV*SS 108 VD L SL+ KIY+ LDHYSP+L HYPGIME L+LI+R + GE+ K V SS Sbjct: 846 VDTLLSLVEKIYIALDHYSPVLQHYPGIMEILKLIKRELTGESTKLVKSS 895 >ref|XP_009800226.1| PREDICTED: WPP domain-associated protein [Nicotiana sylvestris] Length = 898 Score = 66.2 bits (160), Expect = 8e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV*SS 108 VD L SLL KIY+ LDHYSP+L HYPGIME L++I+R + GE+ K V SS Sbjct: 847 VDTLLSLLEKIYIALDHYSPVLQHYPGIMEILKVIKRELTGESTKLVKSS 896 >ref|NP_001067257.1| Os12g0612300 [Oryza sativa Japonica Group] gi|77556585|gb|ABA99381.1| WPP domain associated protein, putative, expressed [Oryza sativa Japonica Group] gi|113649764|dbj|BAF30276.1| Os12g0612300 [Oryza sativa Japonica Group] gi|125580050|gb|EAZ21196.1| hypothetical protein OsJ_36846 [Oryza sativa Japonica Group] Length = 579 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/44 (61%), Positives = 38/44 (86%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETV 126 VDAL S+LGKIY+ LDHYSP+L HYPG+ E L L+++A++GE++ Sbjct: 536 VDALLSILGKIYIALDHYSPVLKHYPGVTEILNLVQKALKGESI 579 >ref|XP_012830201.1| PREDICTED: WPP domain-associated protein [Erythranthe guttatus] Length = 900 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGET 129 VD L LL KIY+GLDHYSP+L HYPGI+E LEL+RR + GE+ Sbjct: 838 VDTLSRLLEKIYIGLDHYSPVLKHYPGIIEILELVRRELRGES 880 >ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-like [Solanum tuberosum] Length = 902 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV*SS 108 VD L SL+ KIY+ LDHYSP+L HYPGIME L+LI+R + GE+ K V SS Sbjct: 851 VDILLSLVEKIYIALDHYSPVLQHYPGIMEILKLIKRELTGESTKLVKSS 900 >ref|XP_009598621.1| PREDICTED: WPP domain-associated protein-like [Nicotiana tomentosiformis] Length = 924 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 257 VDALQSLLGKIYMGLDHYSPILLHYPGIMETLELIRRAIEGETVKPV 117 VD L LL KIY+ LDHYSP+L HYPGI+E L+LIR+ + G++ KPV Sbjct: 877 VDTLLRLLEKIYIALDHYSPVLQHYPGIIEILKLIRKELRGDSAKPV 923