BLASTX nr result
ID: Cinnamomum25_contig00017107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00017107 (399 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109923.1| Cyclin-dependent kinases regulatory subunit ... 84 4e-14 ref|XP_012838324.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_011624257.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_012444712.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_011088804.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010907452.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_011028271.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010557372.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 gb|KHG01535.1| Cyclin-dependent kinases regulatory subunit 1 [Go... 84 4e-14 ref|XP_012475898.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010473194.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010417949.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010510708.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010267302.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_010031422.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_009592163.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_009398042.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_009389135.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_009389130.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 ref|XP_008812331.1| PREDICTED: cyclin-dependent kinases regulato... 84 4e-14 >ref|XP_010109923.1| Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] gi|587938132|gb|EXC24899.1| Cyclin-dependent kinases regulatory subunit 2 [Morus notabilis] Length = 82 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_012838324.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Erythranthe guttatus] Length = 89 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_011624257.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2 [Amborella trichopoda] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_012444712.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii] gi|823223914|ref|XP_012444713.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii] gi|763786549|gb|KJB53545.1| hypothetical protein B456_009G089700 [Gossypium raimondii] gi|763786550|gb|KJB53546.1| hypothetical protein B456_009G089700 [Gossypium raimondii] gi|763786551|gb|KJB53547.1| hypothetical protein B456_009G089700 [Gossypium raimondii] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_011088804.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Sesamum indicum] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010907452.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Elaeis guineensis] gi|743875915|ref|XP_010907453.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Elaeis guineensis] Length = 92 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_011028271.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Populus euphratica] Length = 83 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010557372.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Tarenaya hassleriana] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >gb|KHG01535.1| Cyclin-dependent kinases regulatory subunit 1 [Gossypium arboreum] gi|728850106|gb|KHG29549.1| Cyclin-dependent kinases regulatory subunit 1 [Gossypium arboreum] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_012475898.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Gossypium raimondii] gi|823123488|ref|XP_012475905.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Gossypium raimondii] gi|728843603|gb|KHG23046.1| Cyclin-dependent kinases regulatory subunit 1 [Gossypium arboreum] gi|763741492|gb|KJB08991.1| hypothetical protein B456_001G117400 [Gossypium raimondii] gi|763741493|gb|KJB08992.1| hypothetical protein B456_001G117400 [Gossypium raimondii] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010473194.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Camelina sativa] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010417949.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Camelina sativa] Length = 87 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010510708.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Camelina sativa] Length = 87 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010267302.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] gi|720036283|ref|XP_010267303.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] gi|720036286|ref|XP_010267305.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] gi|720036289|ref|XP_010267306.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_010031422.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Eucalyptus grandis] gi|702473811|ref|XP_010031423.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Eucalyptus grandis] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_009592163.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nicotiana tomentosiformis] gi|698522223|ref|XP_009757926.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nicotiana sylvestris] Length = 88 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_009398042.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Musa acuminata subsp. malaccensis] Length = 92 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_009389135.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Musa acuminata subsp. malaccensis] Length = 93 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_009389130.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Musa acuminata subsp. malaccensis] Length = 93 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73 >ref|XP_008812331.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Phoenix dactylifera] gi|672184066|ref|XP_008812332.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Phoenix dactylifera] gi|672184068|ref|XP_008812333.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Phoenix dactylifera] gi|672184070|ref|XP_008812334.1| PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Phoenix dactylifera] Length = 89 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 399 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 292 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY Sbjct: 38 ENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNY 73