BLASTX nr result
ID: Cinnamomum25_contig00017041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00017041 (381 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216842.1| hypothetical protein PRUPE_ppa022058mg, part... 59 2e-06 >ref|XP_007216842.1| hypothetical protein PRUPE_ppa022058mg, partial [Prunus persica] gi|462412992|gb|EMJ18041.1| hypothetical protein PRUPE_ppa022058mg, partial [Prunus persica] Length = 135 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -2 Query: 380 DEGHGQDGDLDE-FAHRNFSVRYAAFPASAKSSMDLGKDPIDF 255 DEG GQ G+LD+ + HR+FS RYA+ PASAKSSMDLGKD F Sbjct: 92 DEGPGQSGNLDDDYLHRDFSCRYASIPASAKSSMDLGKDGPSF 134