BLASTX nr result
ID: Cinnamomum25_contig00016384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00016384 (398 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010279294.1| PREDICTED: guanine nucleotide-binding protei... 89 1e-15 ref|XP_011091078.1| PREDICTED: guanine nucleotide-binding protei... 86 1e-14 ref|XP_010923513.1| PREDICTED: guanine nucleotide-binding protei... 85 2e-14 emb|CDO99128.1| unnamed protein product [Coffea canephora] 83 8e-14 ref|XP_007050458.1| Ammonium transporter 2 [Theobroma cacao] gi|... 82 1e-13 ref|XP_011621737.1| PREDICTED: uncharacterized protein LOC184295... 82 2e-13 gb|ERN01477.1| hypothetical protein AMTR_s00002p00269650 [Ambore... 82 2e-13 ref|XP_010274260.1| PREDICTED: guanine nucleotide-binding protei... 81 2e-13 ref|XP_008786059.1| PREDICTED: guanine nucleotide-binding protei... 81 3e-13 ref|XP_008449308.1| PREDICTED: guanine nucleotide-binding protei... 81 3e-13 ref|XP_004150567.1| PREDICTED: guanine nucleotide-binding protei... 81 3e-13 ref|XP_009781493.1| PREDICTED: guanine nucleotide-binding protei... 80 4e-13 gb|AGN54390.1| G protein gamma1 subunit, partial [Nicotiana bent... 80 4e-13 ref|XP_012490625.1| PREDICTED: ammonium transporter 3 member 3-l... 80 5e-13 gb|KJB42169.1| hypothetical protein B456_007G140700 [Gossypium r... 80 5e-13 ref|XP_012069733.1| PREDICTED: guanine nucleotide-binding protei... 80 7e-13 ref|XP_009376004.1| PREDICTED: guanine nucleotide-binding protei... 80 7e-13 ref|XP_008341025.1| PREDICTED: guanine nucleotide-binding protei... 80 7e-13 ref|XP_006362154.1| PREDICTED: guanine nucleotide-binding protei... 80 7e-13 ref|XP_007034913.1| G-protein gamma subunit 2 [Theobroma cacao] ... 80 7e-13 >ref|XP_010279294.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Nelumbo nucifera] Length = 105 Score = 88.6 bits (218), Expect = 1e-15 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LL IETRPDPLLPVTNGP NPSWDRWFEGPQ+S+GCRCW+ Sbjct: 64 LLTNIETRPDPLLPVTNGPTNPSWDRWFEGPQDSKGCRCWI 104 >ref|XP_011091078.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Sesamum indicum] Length = 99 Score = 85.9 bits (211), Expect = 1e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LL+ IETRPDPLLPVTNGP NP+WDRWFEGP ES GCRCW+ Sbjct: 58 LLMNIETRPDPLLPVTNGPVNPTWDRWFEGPPESSGCRCWI 98 >ref|XP_010923513.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Elaeis guineensis] Length = 102 Score = 85.1 bits (209), Expect = 2e-14 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LLL++E+RPDPLLPVTNGP NPSWDRWFEGPQ+ GC+CW+ Sbjct: 61 LLLRVESRPDPLLPVTNGPANPSWDRWFEGPQDLHGCKCWI 101 >emb|CDO99128.1| unnamed protein product [Coffea canephora] Length = 96 Score = 82.8 bits (203), Expect = 8e-14 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L K+ETRPDPLLP TNGP PSWDRWFEGPQE GCRCW+ Sbjct: 55 MLSKVETRPDPLLPTTNGPLTPSWDRWFEGPQEKSGCRCWI 95 >ref|XP_007050458.1| Ammonium transporter 2 [Theobroma cacao] gi|508702719|gb|EOX94615.1| Ammonium transporter 2 [Theobroma cacao] Length = 610 Score = 82.0 bits (201), Expect = 1e-13 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LLL +ETRPDPLLP+TNGP NPSWDRWFEGPQ+S+GCRC + Sbjct: 569 LLLSMETRPDPLLPLTNGPINPSWDRWFEGPQDSQGCRCQI 609 >ref|XP_011621737.1| PREDICTED: uncharacterized protein LOC18429562 [Amborella trichopoda] Length = 952 Score = 81.6 bits (200), Expect = 2e-13 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LL+ IE +PDPLLP+TNGP NP+WDRWFEG QES+GCRCW+ Sbjct: 911 LLVLIEAKPDPLLPITNGPANPAWDRWFEGAQESQGCRCWI 951 >gb|ERN01477.1| hypothetical protein AMTR_s00002p00269650 [Amborella trichopoda] Length = 103 Score = 81.6 bits (200), Expect = 2e-13 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LL+ IE +PDPLLP+TNGP NP+WDRWFEG QES+GCRCW+ Sbjct: 62 LLVLIEAKPDPLLPITNGPANPAWDRWFEGAQESQGCRCWI 102 >ref|XP_010274260.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 1-like isoform X1 [Nelumbo nucifera] Length = 105 Score = 81.3 bits (199), Expect = 2e-13 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 L+LKIETR DPLLPVTNG NPSW+RWFEGPQ+S GCRCW+ Sbjct: 64 LMLKIETRSDPLLPVTNGLTNPSWNRWFEGPQDSNGCRCWM 104 >ref|XP_008786059.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Phoenix dactylifera] Length = 102 Score = 80.9 bits (198), Expect = 3e-13 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LLL +E+RPDPLLPVTN P NPSWDRWFEGPQ+ GC+CW+ Sbjct: 61 LLLIVESRPDPLLPVTNAPANPSWDRWFEGPQDLHGCKCWI 101 >ref|XP_008449308.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis melo] Length = 103 Score = 80.9 bits (198), Expect = 3e-13 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L +ETRPDPLLP+T+GP NP WDRWFEGPQ+S+GCRCW+ Sbjct: 62 MLSNVETRPDPLLPLTHGPINPLWDRWFEGPQDSKGCRCWI 102 >ref|XP_004150567.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Cucumis sativus] gi|700206536|gb|KGN61655.1| hypothetical protein Csa_2G215490 [Cucumis sativus] Length = 104 Score = 80.9 bits (198), Expect = 3e-13 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L +ETRPDPLLP+T+GP NP WDRWFEGPQ+S+GCRCW+ Sbjct: 63 MLSNVETRPDPLLPLTHGPINPLWDRWFEGPQDSKGCRCWI 103 >ref|XP_009781493.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Nicotiana sylvestris] Length = 99 Score = 80.5 bits (197), Expect = 4e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L +ETRPDPLLPVT+GP NP WDRWFEGPQ++ GCRCW+ Sbjct: 58 MLSNVETRPDPLLPVTHGPTNPYWDRWFEGPQDTSGCRCWI 98 >gb|AGN54390.1| G protein gamma1 subunit, partial [Nicotiana benthamiana] Length = 99 Score = 80.5 bits (197), Expect = 4e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L +ETRPDPLLPVT+GP NP WDRWFEGPQ++ GCRCW+ Sbjct: 58 MLSNVETRPDPLLPVTHGPTNPYWDRWFEGPQDTSGCRCWI 98 >ref|XP_012490625.1| PREDICTED: ammonium transporter 3 member 3-like [Gossypium raimondii] Length = 576 Score = 80.1 bits (196), Expect = 5e-13 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LLL +ETRPDPLLP+TNGP NPSWDRWFEGPQ+++GCRC + Sbjct: 535 LLLIMETRPDPLLPLTNGPINPSWDRWFEGPQDAKGCRCQI 575 >gb|KJB42169.1| hypothetical protein B456_007G140700 [Gossypium raimondii] Length = 102 Score = 80.1 bits (196), Expect = 5e-13 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 LLL +ETRPDPLLP+TNGP NPSWDRWFEGPQ+++GCRC + Sbjct: 61 LLLIMETRPDPLLPLTNGPINPSWDRWFEGPQDAKGCRCQI 101 >ref|XP_012069733.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2 isoform X1 [Jatropha curcas] Length = 106 Score = 79.7 bits (195), Expect = 7e-13 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L + ++PDPLLP+TNGP NP WDRWFEGPQES+GCRCW+ Sbjct: 65 MLSNVASKPDPLLPITNGPLNPLWDRWFEGPQESKGCRCWI 105 >ref|XP_009376004.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like isoform X1 [Pyrus x bretschneideri] gi|694401973|ref|XP_009376006.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like isoform X2 [Pyrus x bretschneideri] Length = 105 Score = 79.7 bits (195), Expect = 7e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L ETRPDPLLP+T+GP NP WDRWFEGPQ+S+GCRCW+ Sbjct: 64 ILNSAETRPDPLLPITHGPLNPFWDRWFEGPQDSKGCRCWI 104 >ref|XP_008341025.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Malus domestica] Length = 105 Score = 79.7 bits (195), Expect = 7e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L ETRPDPLLP+T+GP NP WDRWFEGPQ+S+GCRCW+ Sbjct: 64 ILNSAETRPDPLLPITHGPLNPFWDRWFEGPQDSKGCRCWI 104 >ref|XP_006362154.1| PREDICTED: guanine nucleotide-binding protein subunit gamma 2-like [Solanum tuberosum] Length = 99 Score = 79.7 bits (195), Expect = 7e-13 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L +ETRPDPLLPVT+GP NPSWDRWFEG Q++ GCRCW+ Sbjct: 58 MLSNVETRPDPLLPVTHGPTNPSWDRWFEGAQDASGCRCWI 98 >ref|XP_007034913.1| G-protein gamma subunit 2 [Theobroma cacao] gi|508713942|gb|EOY05839.1| G-protein gamma subunit 2 [Theobroma cacao] Length = 106 Score = 79.7 bits (195), Expect = 7e-13 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -2 Query: 397 LLLKIETRPDPLLPVTNGPPNPSWDRWFEGPQESRGCRCWV 275 +L +E+RPDPLLPVTNGP NP WDRWFEGPQ+++GC+CW+ Sbjct: 65 MLSNVESRPDPLLPVTNGPLNPLWDRWFEGPQDAQGCKCWI 105