BLASTX nr result
ID: Cinnamomum25_contig00015971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00015971 (564 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259397.1| PREDICTED: dnaJ homolog subfamily B member 3... 63 1e-07 ref|XP_010268069.1| PREDICTED: dnaJ homolog subfamily B member 3... 58 3e-06 ref|XP_010674147.1| PREDICTED: dnaJ homolog subfamily B member 3... 57 5e-06 >ref|XP_010259397.1| PREDICTED: dnaJ homolog subfamily B member 3 isoform X1 [Nelumbo nucifera] Length = 172 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 563 AGMYDPLEEEDEGFSDFMEEMLSMMDNVRAE 471 AG+YDP EEEDEGFSDFM+EMLSMMDNVRAE Sbjct: 78 AGLYDPFEEEDEGFSDFMQEMLSMMDNVRAE 108 >ref|XP_010268069.1| PREDICTED: dnaJ homolog subfamily B member 3-like isoform X1 [Nelumbo nucifera] Length = 170 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 563 AGMYDPLEEEDEGFSDFMEEMLSMMDNVRAE 471 AG+YDPLEEED+GF DFM+EMLSMM++VRAE Sbjct: 78 AGLYDPLEEEDQGFCDFMQEMLSMMEDVRAE 108 >ref|XP_010674147.1| PREDICTED: dnaJ homolog subfamily B member 3 [Beta vulgaris subsp. vulgaris] gi|870862616|gb|KMT13804.1| hypothetical protein BVRB_4g076510 [Beta vulgaris subsp. vulgaris] Length = 167 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 563 AGMYDPLEEEDEGFSDFMEEMLSMMDNVRAE 471 AG YDP EEED+GF DFM+EMLSMMDNVR E Sbjct: 84 AGFYDPTEEEDQGFCDFMQEMLSMMDNVRGE 114