BLASTX nr result
ID: Cinnamomum25_contig00013562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00013562 (355 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN04942.1| hypothetical protein AMTR_s00080p00130620 [Ambore... 65 2e-08 >gb|ERN04942.1| hypothetical protein AMTR_s00080p00130620 [Amborella trichopoda] Length = 159 Score = 64.7 bits (156), Expect = 2e-08 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 1/106 (0%) Frame = -2 Query: 321 LQLLCAKKLTNPDLNDHFNRFVFHIADVRNGIFPCLTPQQELDLEGGSPIPVVGCDQNGG 142 LQ +C K LT D H NR V N IFP LT + +E + + D+ G Sbjct: 43 LQPVCHKTLTPSDTEPHLNRLALPKTQVNNQIFPLLTEAEIRRVEEEGGLELCAFDKEGR 102 Query: 141 RWDLQFKNRRQTGRNSPTYILQGQWTSMARENGWREE-EVLNIWGF 7 W+L FK ++S TY+L +W M NGWR + L +W F Sbjct: 103 AWNLIFK----YWKSSQTYVLIDEWMGMVVRNGWRSHTDALTVWCF 144