BLASTX nr result
ID: Cinnamomum25_contig00013472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00013472 (367 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ35251.1| cyclin-dependent kinase inhibitor [Persea americana] 107 3e-21 ref|XP_006846847.2| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 ref|XP_011628188.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 gb|ERN18910.1| hypothetical protein AMTR_s00067p00172510 [Ambore... 61 3e-07 gb|ERN08428.1| hypothetical protein AMTR_s01954p00002310, partia... 61 3e-07 ref|XP_009348241.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 ref|XP_009342425.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 ref|XP_009374605.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 ref|XP_004296651.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 ref|XP_012071158.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 6e-07 ref|XP_010920331.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 7e-07 emb|CBI17323.3| unnamed protein product [Vitis vinifera] 60 7e-07 ref|XP_007144151.1| hypothetical protein PHAVU_007G133100g [Phas... 60 7e-07 gb|AHA84152.1| cyclin-dependent kinase inhibitor [Phaseolus vulg... 60 7e-07 ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 7e-07 ref|XP_002268785.1| PREDICTED: cyclin-dependent kinase inhibitor... 60 7e-07 emb|CAN70215.1| hypothetical protein VITISV_012042 [Vitis vinifera] 60 7e-07 ref|XP_008348906.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 1e-06 ref|XP_008224489.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 1e-06 ref|XP_010264097.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 1e-06 >gb|AEZ35251.1| cyclin-dependent kinase inhibitor [Persea americana] Length = 218 Score = 107 bits (267), Expect = 3e-21 Identities = 65/122 (53%), Positives = 66/122 (54%) Frame = -1 Query: 367 RSRRLXXXXXXXXXXXXXXEGCKQKCIXXXXXXXXXXXXXXXXXXXXXXXXXGEQEGLWQ 188 RSRRL EGCKQKC GE+EGLW Sbjct: 53 RSRRLEKPVAAEEEAKKPKEGCKQKCSSNSRLGSVSVNSGSVGSVSVSFSTNGEEEGLWP 112 Query: 187 DMEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPGXXXXXXXXXXXXXRKHNTMSR 8 DMEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG RK NTMSR Sbjct: 113 DMEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPGSTTRRTRATASTRRKQNTMSR 172 Query: 7 SI 2 I Sbjct: 173 II 174 >ref|XP_006846847.2| PREDICTED: cyclin-dependent kinase inhibitor 5, partial [Amborella trichopoda] Length = 229 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENV++++ RER +RETTPSSLIRDPE+LE PG Sbjct: 147 VEASFGENVVDFDVRERGIRETTPSSLIRDPESLETPG 184 >ref|XP_011628188.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Amborella trichopoda] Length = 233 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENV++++ RER +RETTPSSLIRDPE+LE PG Sbjct: 147 VEASFGENVVDFDVRERGIRETTPSSLIRDPESLETPG 184 >gb|ERN18910.1| hypothetical protein AMTR_s00067p00172510 [Amborella trichopoda] Length = 239 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENV++++ RER +RETTPSSLIRDPE+LE PG Sbjct: 131 VEASFGENVVDFDVRERGIRETTPSSLIRDPESLETPG 168 >gb|ERN08428.1| hypothetical protein AMTR_s01954p00002310, partial [Amborella trichopoda] Length = 213 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENV++++ RER +RETTPSSLIRDPE+LE PG Sbjct: 131 VEASFGENVVDFDVRERGIRETTPSSLIRDPESLETPG 168 >ref|XP_009348241.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Pyrus x bretschneideri] gi|694443273|ref|XP_009348242.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Pyrus x bretschneideri] Length = 236 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVLE+EGRER RE+TP SLIRDP+T+ PG Sbjct: 131 EASFGENVLEFEGRERTTRESTPCSLIRDPDTIRTPG 167 >ref|XP_009342425.1| PREDICTED: cyclin-dependent kinase inhibitor 4-like [Pyrus x bretschneideri] Length = 236 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVLE+EGRER RE+TP SLIRDP+T+ PG Sbjct: 131 EASFGENVLEFEGRERTTRESTPCSLIRDPDTIRTPG 167 >ref|XP_009374605.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Pyrus x bretschneideri] Length = 236 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVLE+EGRER RE+TP SLIRDP+T+ PG Sbjct: 131 EASFGENVLEFEGRERTTRESTPCSLIRDPDTIRTPG 167 >ref|XP_004296651.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Fragaria vesca subsp. vesca] Length = 219 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVLE+EGRER RE+TP SLIRDP+T+ PG Sbjct: 114 EASFGENVLEFEGRERTTRESTPCSLIRDPDTIRTPG 150 >ref|XP_012071158.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Jatropha curcas] gi|643732187|gb|KDP39379.1| hypothetical protein JCGZ_01136 [Jatropha curcas] Length = 254 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENVL+ EGRER+ RE+TP SLIRDPET+ PG Sbjct: 148 IEASFGENVLDIEGRERSTRESTPCSLIRDPETIRTPG 185 >ref|XP_010920331.1| PREDICTED: cyclin-dependent kinase inhibitor 4-like [Elaeis guineensis] Length = 205 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = -1 Query: 187 DMEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPGXXXXXXXXXXXXXRKHNTMSR 8 + E S GENVLE E R+R+VRETTP SLIRD ET+ PG R HN+M R Sbjct: 98 EAEVSSGENVLEAEARDRSVRETTPCSLIRDSETIGTPGSTTRPTSSTATNRRMHNSMRR 157 Query: 7 SI 2 +I Sbjct: 158 NI 159 >emb|CBI17323.3| unnamed protein product [Vitis vinifera] Length = 203 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENVL++E R+R+ RETTP SLIRDPET+ PG Sbjct: 97 IEASFGENVLDFEARDRSTRETTPCSLIRDPETIRTPG 134 >ref|XP_007144151.1| hypothetical protein PHAVU_007G133100g [Phaseolus vulgaris] gi|561017341|gb|ESW16145.1| hypothetical protein PHAVU_007G133100g [Phaseolus vulgaris] Length = 226 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVL++EGRER+ RE+TP SLIRDP+T+ PG Sbjct: 121 EASFGENVLDFEGRERSTRESTPCSLIRDPDTVRTPG 157 >gb|AHA84152.1| cyclin-dependent kinase inhibitor [Phaseolus vulgaris] Length = 226 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVL++EGRER+ RE+TP SLIRDP+T+ PG Sbjct: 121 EASFGENVLDFEGRERSTRESTPCSLIRDPDTVRTPG 157 >ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor 3-like [Vitis vinifera] gi|297744341|emb|CBI37311.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENVLE+EGR+R+ RE+TP SLIRDP+T+ PG Sbjct: 112 VEASYGENVLEFEGRDRSTRESTPCSLIRDPDTIATPG 149 >ref|XP_002268785.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Vitis vinifera] Length = 263 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENVL++E R+R+ RETTP SLIRDPET+ PG Sbjct: 157 IEASFGENVLDFEARDRSTRETTPCSLIRDPETIRTPG 194 >emb|CAN70215.1| hypothetical protein VITISV_012042 [Vitis vinifera] Length = 252 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 +EAS GENVL++E R+R+ RETTP SLIRDPET+ PG Sbjct: 146 IEASFGENVLDFEARDRSTRETTPCSLIRDPETIRTPG 183 >ref|XP_008348906.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like [Malus domestica] Length = 236 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVLE+EGRER RE+TP SLIRDP T+ +PG Sbjct: 131 EASFGENVLEFEGRERITRESTPCSLIRDPNTIRSPG 167 >ref|XP_008224489.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Prunus mume] Length = 245 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 181 EASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPG 71 EAS GENVLE EGRER RE+TP SLIRDP+T+ PG Sbjct: 140 EASFGENVLELEGRERTTRESTPCSLIRDPDTIRTPG 176 >ref|XP_010264097.1| PREDICTED: cyclin-dependent kinase inhibitor 5 [Nelumbo nucifera] Length = 255 Score = 58.9 bits (141), Expect = 1e-06 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = -1 Query: 184 MEASLGENVLEYEGRERNVRETTPSSLIRDPETLEAPGXXXXXXXXXXXXXRKHNTMSRS 5 +EAS GENVLE EGRERN RETTP SLIRD +T+ PG R N R+ Sbjct: 149 IEASFGENVLEIEGRERNNRETTPCSLIRDSDTIGTPGSTTRPINSTVTNRRSQNAAERN 208 Query: 4 I 2 I Sbjct: 209 I 209