BLASTX nr result
ID: Cinnamomum25_contig00013296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00013296 (718 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform ... 156 1e-35 gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arbor... 155 3e-35 ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitoch... 152 2e-34 ref|XP_006447155.1| hypothetical protein CICLE_v10017154mg [Citr... 152 2e-34 gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium r... 151 3e-34 ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitoch... 151 3e-34 ref|XP_004250113.1| PREDICTED: 54S ribosomal protein L37, mitoch... 151 4e-34 ref|XP_002509570.1| conserved hypothetical protein [Ricinus comm... 150 5e-34 ref|XP_011097320.1| PREDICTED: 54S ribosomal protein L37, mitoch... 150 7e-34 ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitoch... 150 9e-34 ref|XP_010551921.1| PREDICTED: 54S ribosomal protein L37, mitoch... 149 1e-33 ref|XP_012840721.1| PREDICTED: 54S ribosomal protein L37, mitoch... 149 1e-33 ref|XP_004302085.1| PREDICTED: 54S ribosomal protein L37, mitoch... 149 2e-33 gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium r... 149 2e-33 ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitoch... 149 2e-33 ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitoch... 149 2e-33 ref|XP_004515056.1| PREDICTED: 54S ribosomal protein L37, mitoch... 149 2e-33 emb|CDP00969.1| unnamed protein product [Coffea canephora] 147 5e-33 ref|XP_006353208.1| PREDICTED: 39S ribosomal protein L54, mitoch... 147 8e-33 ref|XP_009800845.1| PREDICTED: 54S ribosomal protein L37, mitoch... 146 1e-32 >ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646903|ref|XP_007031751.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646906|ref|XP_007031752.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646909|ref|XP_007031753.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646912|ref|XP_007031754.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710779|gb|EOY02676.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710780|gb|EOY02677.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710781|gb|EOY02678.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710782|gb|EOY02679.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710783|gb|EOY02680.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] Length = 131 Score = 156 bits (394), Expect = 1e-35 Identities = 74/84 (88%), Positives = 80/84 (95%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 SILSKEVK+TTVVGANILKDGADPKI+PDSEYPDWLWHLL K P LSEL+R+N+E LPYE Sbjct: 48 SILSKEVKSTTVVGANILKDGADPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYE 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENN+VKAKN Sbjct: 108 DLKRFVKLDNRARIKENNAVKAKN 131 >gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arboreum] Length = 131 Score = 155 bits (391), Expect = 3e-35 Identities = 72/84 (85%), Positives = 79/84 (94%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S+LSKEVK+TTVVGANILKDG DPKI+PDSEYPDWLWHLL K P LSEL+R+N+E LPYE Sbjct: 48 SVLSKEVKSTTVVGANILKDGTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYE 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNS+KAKN Sbjct: 108 DLKRFVKLDNRARIKENNSIKAKN 131 >ref|XP_010033374.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|702481840|ref|XP_010033375.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|702481844|ref|XP_010033376.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Eucalyptus grandis] gi|629086637|gb|KCW52994.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] gi|629086638|gb|KCW52995.1| hypothetical protein EUGRSUZ_J02294 [Eucalyptus grandis] Length = 133 Score = 152 bits (383), Expect = 2e-34 Identities = 72/84 (85%), Positives = 79/84 (94%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKEVK+TTVVGANILKDGADPK+LPDSEYPDWL HL+ K PPLSEL+R+N+E LPYE Sbjct: 50 STLSKEVKSTTVVGANILKDGADPKVLPDSEYPDWLCHLIDKKPPLSELRRKNVETLPYE 109 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNS+KAKN Sbjct: 110 DLKRFVKLDNRARIKENNSIKAKN 133 >ref|XP_006447155.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|567909685|ref|XP_006447156.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|568831453|ref|XP_006469980.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831457|ref|XP_006469981.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X2 [Citrus sinensis] gi|557549766|gb|ESR60395.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|557549767|gb|ESR60396.1| hypothetical protein CICLE_v10017154mg [Citrus clementina] gi|641821759|gb|KDO41387.1| hypothetical protein CISIN_1g032859mg [Citrus sinensis] Length = 132 Score = 152 bits (383), Expect = 2e-34 Identities = 71/84 (84%), Positives = 79/84 (94%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 SILSKEVK+TTVVGANILK+G+DPK+LPDSEYPDWLWHLL K P LSELK +N+E LPYE Sbjct: 49 SILSKEVKSTTVVGANILKEGSDPKVLPDSEYPDWLWHLLEKRPALSELKMKNIETLPYE 108 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRF+KLDNRA+IKENNSVKAKN Sbjct: 109 DLKRFLKLDNRAKIKENNSVKAKN 132 >gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 147 Score = 151 bits (382), Expect = 3e-34 Identities = 71/84 (84%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 SILSKEVK+TTVVGANILKDG DPKI+PDSEYPDW+WHLL K P LSEL+R+N+E LPYE Sbjct: 64 SILSKEVKSTTVVGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYE 123 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRA IKENNS+KAKN Sbjct: 124 DLKRFVKLDNRALIKENNSIKAKN 147 >ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|823249089|ref|XP_012457196.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|763803899|gb|KJB70837.1| hypothetical protein B456_011G092800 [Gossypium raimondii] gi|763803901|gb|KJB70839.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 131 Score = 151 bits (382), Expect = 3e-34 Identities = 71/84 (84%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 SILSKEVK+TTVVGANILKDG DPKI+PDSEYPDW+WHLL K P LSEL+R+N+E LPYE Sbjct: 48 SILSKEVKSTTVVGANILKDGTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYE 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRA IKENNS+KAKN Sbjct: 108 DLKRFVKLDNRALIKENNSIKAKN 131 >ref|XP_004250113.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Solanum lycopersicum] Length = 130 Score = 151 bits (381), Expect = 4e-34 Identities = 71/84 (84%), Positives = 79/84 (94%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S +SKEVKA+TVVGANILKDGADPK+LPDSEYPDWLWHLL K P LSEL+R+NLE+LPY+ Sbjct: 47 STISKEVKASTVVGANILKDGADPKVLPDSEYPDWLWHLLDKRPALSELRRKNLESLPYD 106 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLD RARIKENNSV+AKN Sbjct: 107 DLKRFVKLDTRARIKENNSVRAKN 130 >ref|XP_002509570.1| conserved hypothetical protein [Ricinus communis] gi|223549469|gb|EEF50957.1| conserved hypothetical protein [Ricinus communis] Length = 130 Score = 150 bits (380), Expect = 5e-34 Identities = 72/82 (87%), Positives = 77/82 (93%) Frame = -3 Query: 416 LSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYEDL 237 LSKEVK+TTVVGANILKDGADPKILPDS+YPDWLWHLL K PLSEL+R+N+E LPYEDL Sbjct: 49 LSKEVKSTTVVGANILKDGADPKILPDSDYPDWLWHLLDKRLPLSELRRKNIETLPYEDL 108 Query: 236 KRFVKLDNRARIKENNSVKAKN 171 KRFVKLDNRA IKENNSVKAKN Sbjct: 109 KRFVKLDNRASIKENNSVKAKN 130 >ref|XP_011097320.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Sesamum indicum] Length = 132 Score = 150 bits (379), Expect = 7e-34 Identities = 71/84 (84%), Positives = 79/84 (94%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S+LSKEVK+TTV GANILKDG DPKILPDSEYPDWLWHLL K P LSEL+R+++E+LPYE Sbjct: 49 SLLSKEVKSTTVFGANILKDGQDPKILPDSEYPDWLWHLLDKRPALSELRRKDVESLPYE 108 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNS+KAKN Sbjct: 109 DLKRFVKLDNRARIKENNSLKAKN 132 >ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nelumbo nucifera] Length = 132 Score = 150 bits (378), Expect = 9e-34 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 SILSKE+K+TTVVGANILKDGADPKILPDSEYPDWLWHLL K P LSEL+R+N+E LPY+ Sbjct: 49 SILSKEMKSTTVVGANILKDGADPKILPDSEYPDWLWHLLDKKPALSELRRKNIETLPYD 108 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 +LKRFVKLDNRARIKENN ++AKN Sbjct: 109 ELKRFVKLDNRARIKENNVIRAKN 132 >ref|XP_010551921.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Tarenaya hassleriana] gi|729390048|ref|XP_010551922.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Tarenaya hassleriana] Length = 130 Score = 149 bits (377), Expect = 1e-33 Identities = 70/84 (83%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKE+K+TTV GANILKDGADPKILPDSEYPDWLWHLL KHP LSEL+R+++E LPY+ Sbjct: 47 SSLSKEIKSTTVFGANILKDGADPKILPDSEYPDWLWHLLDKHPALSELRRKDVETLPYD 106 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLD RARIKENNSV+AKN Sbjct: 107 DLKRFVKLDTRARIKENNSVRAKN 130 >ref|XP_012840721.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Erythranthe guttatus] gi|848880691|ref|XP_012840722.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Erythranthe guttatus] gi|604329451|gb|EYU34782.1| hypothetical protein MIMGU_mgv1a016197mg [Erythranthe guttata] gi|604329452|gb|EYU34783.1| hypothetical protein MIMGU_mgv1a016197mg [Erythranthe guttata] Length = 131 Score = 149 bits (377), Expect = 1e-33 Identities = 70/84 (83%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S+LS EVK+TTV GANILKDG DPKILPDSEYPDWLWHLL K PPLSELKR++++ LPY+ Sbjct: 48 SLLSNEVKSTTVFGANILKDGQDPKILPDSEYPDWLWHLLDKKPPLSELKRKDIKTLPYD 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNS+KAKN Sbjct: 108 DLKRFVKLDNRARIKENNSLKAKN 131 >ref|XP_004302085.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 133 Score = 149 bits (376), Expect = 2e-33 Identities = 70/84 (83%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 SIL KEVK+TTVVGANILKDG DPKILPDSEYP+WLWHL+ K P LSEL+R+++E LPYE Sbjct: 50 SILDKEVKSTTVVGANILKDGTDPKILPDSEYPEWLWHLVDKRPALSELRRKDIETLPYE 109 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNS+KAKN Sbjct: 110 DLKRFVKLDNRARIKENNSLKAKN 133 >gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 126 Score = 149 bits (375), Expect = 2e-33 Identities = 72/84 (85%), Positives = 77/84 (91%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKEVK+TTVVGANILKDGADPKI DSEYPDWLWHLL K P LSEL+R+++E LPYE Sbjct: 43 STLSKEVKSTTVVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYE 102 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNSVKAKN Sbjct: 103 DLKRFVKLDNRARIKENNSVKAKN 126 >ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Gossypium raimondii] gi|763807697|gb|KJB74599.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 144 Score = 149 bits (375), Expect = 2e-33 Identities = 72/84 (85%), Positives = 77/84 (91%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKEVK+TTVVGANILKDGADPKI DSEYPDWLWHLL K P LSEL+R+++E LPYE Sbjct: 61 STLSKEVKSTTVVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYE 120 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNSVKAKN Sbjct: 121 DLKRFVKLDNRARIKENNSVKAKN 144 >ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Gossypium raimondii] gi|763807696|gb|KJB74598.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 131 Score = 149 bits (375), Expect = 2e-33 Identities = 72/84 (85%), Positives = 77/84 (91%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKEVK+TTVVGANILKDGADPKI DSEYPDWLWHLL K P LSEL+R+++E LPYE Sbjct: 48 STLSKEVKSTTVVGANILKDGADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYE 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNSVKAKN Sbjct: 108 DLKRFVKLDNRARIKENNSVKAKN 131 >ref|XP_004515056.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Cicer arietinum] Length = 132 Score = 149 bits (375), Expect = 2e-33 Identities = 71/84 (84%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKE+K+TTVVGANILK+G DPKILP SEYPDWLWHLL K P LSEL+R+NLEALPYE Sbjct: 49 SSLSKEIKSTTVVGANILKEGTDPKILPYSEYPDWLWHLLDKRPALSELRRKNLEALPYE 108 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKR+VKLDNRARIKENNS+KAKN Sbjct: 109 DLKRYVKLDNRARIKENNSLKAKN 132 >emb|CDP00969.1| unnamed protein product [Coffea canephora] Length = 131 Score = 147 bits (372), Expect = 5e-33 Identities = 72/84 (85%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S LSKEVK+TTVVGANILKDGADPKILPDSEYP+WL HLL K P LSEL+R++LE LPYE Sbjct: 48 STLSKEVKSTTVVGANILKDGADPKILPDSEYPEWLSHLLDKRPALSELRRKDLETLPYE 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLDNRARIKENNS+KAKN Sbjct: 108 DLKRFVKLDNRARIKENNSIKAKN 131 >ref|XP_006353208.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565373292|ref|XP_006353209.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565373294|ref|XP_006353210.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 131 Score = 147 bits (370), Expect = 8e-33 Identities = 69/84 (82%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S +SKEVKA+TVVGANILKDGADPK+LPDS+YPDWLWHLL K LSEL+R+NLE+LPY+ Sbjct: 48 STISKEVKASTVVGANILKDGADPKVLPDSDYPDWLWHLLDKRSALSELRRKNLESLPYD 107 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLD RARIKENNSV+AKN Sbjct: 108 DLKRFVKLDTRARIKENNSVRAKN 131 >ref|XP_009800845.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nicotiana sylvestris] Length = 132 Score = 146 bits (369), Expect = 1e-32 Identities = 69/84 (82%), Positives = 78/84 (92%) Frame = -3 Query: 422 SILSKEVKATTVVGANILKDGADPKILPDSEYPDWLWHLLAKHPPLSELKRRNLEALPYE 243 S +SKEVKA+TVVGANILKDGADPK+L DSEYPDWLWHLL K P LSEL+R++LE+LPY+ Sbjct: 49 SSISKEVKASTVVGANILKDGADPKVLADSEYPDWLWHLLDKRPALSELRRKDLESLPYD 108 Query: 242 DLKRFVKLDNRARIKENNSVKAKN 171 DLKRFVKLD RARIKENNS+KAKN Sbjct: 109 DLKRFVKLDTRARIKENNSIKAKN 132