BLASTX nr result
ID: Cinnamomum25_contig00012557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00012557 (216 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003839870.1| predicted protein [Leptosphaeria maculans JN... 69 3e-12 >ref|XP_003839870.1| predicted protein [Leptosphaeria maculans JN3] gi|312216440|emb|CBX96391.1| predicted protein [Leptosphaeria maculans JN3] Length = 124 Score = 69.3 bits (168), Expect(2) = 3e-12 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 32 NLSPGWPCCASPIRPPRGVVRDRGLYPTARTDAGLPAEECTRLEP 166 +LSPGW SPIRPPR VRDR LYPTA+TDAGLP EECT +P Sbjct: 79 DLSPGWLHVVSPIRPPRREVRDRDLYPTAQTDAGLPVEECTGQKP 123 Score = 28.5 bits (62), Expect(2) = 3e-12 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 1 PLRQHPSRCAEPQSG 45 PLRQHPSRCA+ G Sbjct: 69 PLRQHPSRCADLSPG 83