BLASTX nr result
ID: Cinnamomum25_contig00011963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00011963 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010066985.1| PREDICTED: glutamine synthetase cytosolic is... 120 2e-31 gb|KDO50819.1| hypothetical protein CISIN_1g018434mg [Citrus sin... 116 7e-31 gb|KDO52770.1| hypothetical protein CISIN_1g018391mg [Citrus sin... 114 1e-29 gb|KCW44354.1| hypothetical protein EUGRSUZ_L021752, partial [Eu... 114 2e-28 ref|XP_010314231.1| PREDICTED: glutamine synthetase cytosolic is... 102 8e-26 ref|XP_011073176.1| PREDICTED: glutamine synthetase nodule isozy... 121 2e-25 ref|XP_012852755.1| PREDICTED: glutamine synthetase cytosolic is... 121 2e-25 ref|XP_010652433.1| PREDICTED: glutamine synthetase isoform X1 [... 121 2e-25 ref|XP_011083120.1| PREDICTED: glutamine synthetase cytosolic is... 120 3e-25 gb|KHN07539.1| Glutamine synthetase nodule isozyme [Glycine soja] 120 3e-25 ref|XP_010066984.1| PREDICTED: glutamine synthetase cytosolic is... 120 3e-25 gb|AAX18864.1| chloroplast glutamine synthetase, partial [Glycin... 120 3e-25 ref|XP_006844043.1| PREDICTED: glutamine synthetase nodule isozy... 120 3e-25 ref|NP_001242332.1| cytosolic glutamine synthetase beta2 [Glycin... 120 3e-25 emb|CAA73366.1| glutamine synthetase [Lotus japonicus] 120 4e-25 emb|CAA63963.1| glutamate synthetase [Lotus japonicus] 120 4e-25 sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytos... 120 4e-25 gb|AID48673.1| theanine synthetase [Camellia oleifera] 120 5e-25 gb|AAX18865.1| chloroplast glutamine synthetase, partial [Glycin... 120 5e-25 ref|XP_006590378.1| PREDICTED: glutamine synthetase cytosolic is... 120 5e-25 >ref|XP_010066985.1| PREDICTED: glutamine synthetase cytosolic isozyme-like isoform X2 [Eucalyptus grandis] Length = 338 Score = 120 bits (302), Expect(2) = 2e-31 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 Score = 42.0 bits (97), Expect(2) = 2e-31 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -1 Query: 78 NTKSMRNEGGIEVIETAIEKLGLRHK 1 +TKSMR GG+ VI+ AIEKLGLRHK Sbjct: 235 STKSMREHGGLNVIKKAIEKLGLRHK 260 >gb|KDO50819.1| hypothetical protein CISIN_1g018434mg [Citrus sinensis] Length = 331 Score = 116 bits (290), Expect(2) = 7e-31 Identities = 48/53 (90%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WP+GG+PGPQGPYYCG+GADKA+GRDIVD+HYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPIGGYPGPQGPYYCGVGADKAWGRDIVDSHYKACLYAGINISGINGEVMPGQ 197 Score = 44.3 bits (103), Expect(2) = 7e-31 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -1 Query: 78 NTKSMRNEGGIEVIETAIEKLGLRH 4 +TKSMRN+GG EVI+ AIEKLGLRH Sbjct: 228 STKSMRNDGGFEVIKKAIEKLGLRH 252 >gb|KDO52770.1| hypothetical protein CISIN_1g018391mg [Citrus sinensis] Length = 338 Score = 114 bits (285), Expect(2) = 1e-29 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGG+PGPQGPYYCG+GADKA GRDIV++HYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGYPGPQGPYYCGVGADKALGRDIVNSHYKACLYAGINISGINGEVMPGQ 197 Score = 42.4 bits (98), Expect(2) = 1e-29 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -1 Query: 78 NTKSMRNEGGIEVIETAIEKLGLRH 4 +TKSMRN+GGI+VI+ AIEKLG RH Sbjct: 235 STKSMRNDGGIDVIKKAIEKLGKRH 259 >gb|KCW44354.1| hypothetical protein EUGRSUZ_L021752, partial [Eucalyptus grandis] Length = 274 Score = 114 bits (285), Expect(2) = 2e-28 Identities = 48/53 (90%), Positives = 51/53 (96%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGG+PGPQGPYYCG+GADK+FGRDI DAHYKACLYAGINISG NGEVMPGQ Sbjct: 72 WPVGGYPGPQGPYYCGVGADKSFGRDISDAHYKACLYAGINISGTNGEVMPGQ 124 Score = 37.7 bits (86), Expect(2) = 2e-28 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 78 NTKSMRNEGGIEVIETAIEKLGLRHK 1 +TKSMR EGG EVI+ AI L LRHK Sbjct: 155 STKSMREEGGFEVIKKAILNLSLRHK 180 >ref|XP_010314231.1| PREDICTED: glutamine synthetase cytosolic isozyme-like isoform X2 [Solanum lycopersicum] Length = 334 Score = 102 bits (254), Expect(2) = 8e-26 Identities = 41/53 (77%), Positives = 49/53 (92%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WP+GG+ GPQGPY+CG+GA+KAFGRDIV++HYKACLYAG+NI GIN EVM GQ Sbjct: 148 WPIGGYRGPQGPYFCGVGAEKAFGRDIVNSHYKACLYAGVNIGGINAEVMAGQ 200 Score = 41.2 bits (95), Expect(2) = 8e-26 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -1 Query: 78 NTKSMRNEGGIEVIETAIEKLGLRHK 1 +TKSMR +GG+EVI AIEKLG RHK Sbjct: 231 STKSMRADGGLEVINKAIEKLGKRHK 256 >ref|XP_011073176.1| PREDICTED: glutamine synthetase nodule isozyme-like [Sesamum indicum] Length = 400 Score = 121 bits (303), Expect = 2e-25 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 189 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 241 >ref|XP_012852755.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Erythranthe guttatus] gi|604305369|gb|EYU24513.1| hypothetical protein MIMGU_mgv1a008973mg [Erythranthe guttata] Length = 356 Score = 121 bits (303), Expect = 2e-25 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >ref|XP_010652433.1| PREDICTED: glutamine synthetase isoform X1 [Vitis vinifera] gi|147768273|emb|CAN62668.1| hypothetical protein VITISV_041911 [Vitis vinifera] gi|297737933|emb|CBI27134.3| unnamed protein product [Vitis vinifera] Length = 356 Score = 121 bits (303), Expect = 2e-25 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >ref|XP_011083120.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Sesamum indicum] Length = 356 Score = 120 bits (302), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGIN+SGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINVSGINGEVMPGQ 197 >gb|KHN07539.1| Glutamine synthetase nodule isozyme [Glycine soja] Length = 356 Score = 120 bits (302), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >ref|XP_010066984.1| PREDICTED: glutamine synthetase cytosolic isozyme-like isoform X1 [Eucalyptus grandis] gi|629099281|gb|KCW65046.1| hypothetical protein EUGRSUZ_G02570 [Eucalyptus grandis] Length = 356 Score = 120 bits (302), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >gb|AAX18864.1| chloroplast glutamine synthetase, partial [Glycine max] Length = 281 Score = 120 bits (302), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 89 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 141 >ref|XP_006844043.1| PREDICTED: glutamine synthetase nodule isozyme [Amborella trichopoda] gi|548846442|gb|ERN05718.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda] Length = 356 Score = 120 bits (302), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >ref|NP_001242332.1| cytosolic glutamine synthetase beta2 [Glycine max] gi|255645255|gb|ACU23125.1| unknown [Glycine max] Length = 356 Score = 120 bits (302), Expect = 3e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >emb|CAA73366.1| glutamine synthetase [Lotus japonicus] Length = 356 Score = 120 bits (301), Expect = 4e-25 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WP+GGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAG+NISGINGEVMPGQ Sbjct: 145 WPIGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQ 197 >emb|CAA63963.1| glutamate synthetase [Lotus japonicus] Length = 356 Score = 120 bits (301), Expect = 4e-25 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WP+GGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAG+NISGINGEVMPGQ Sbjct: 145 WPIGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQ 197 >sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus] Length = 356 Score = 120 bits (301), Expect = 4e-25 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WP+GGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAG+NISGINGEVMPGQ Sbjct: 145 WPIGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQ 197 >gb|AID48673.1| theanine synthetase [Camellia oleifera] Length = 356 Score = 120 bits (300), Expect = 5e-25 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGG+PGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ Sbjct: 145 WPVGGYPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 197 >gb|AAX18865.1| chloroplast glutamine synthetase, partial [Glycine max] Length = 281 Score = 120 bits (300), Expect = 5e-25 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKAC+YAGINISGINGEVMPGQ Sbjct: 89 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQ 141 >ref|XP_006590378.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 isoform X2 [Glycine max] Length = 272 Score = 120 bits (300), Expect = 5e-25 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = -3 Query: 235 WPVGGFPGPQGPYYCGIGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQ 77 WPVGGFPGPQGPYYCG+GADKAFGRDIVDAHYKAC+YAGINISGINGEVMPGQ Sbjct: 145 WPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACIYAGINISGINGEVMPGQ 197