BLASTX nr result
ID: Cinnamomum25_contig00011503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00011503 (324 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486345.1| PREDICTED: FK506-binding protein 5-like [Cic... 60 6e-07 ref|XP_008785647.1| PREDICTED: FK506-binding protein 5-like [Pho... 59 2e-06 ref|XP_002308765.1| hypothetical protein POPTR_0006s00790g [Popu... 59 2e-06 ref|XP_012849169.1| PREDICTED: neurofilament medium polypeptide-... 58 2e-06 ref|XP_012849168.1| PREDICTED: UPF0329 protein ECU05_1680/ECU11_... 58 2e-06 ref|XP_004293397.1| PREDICTED: neurofilament medium polypeptide-... 58 2e-06 ref|XP_008790335.1| PREDICTED: UPF0329 protein ECU05_1680/ECU11_... 57 4e-06 gb|KEH36987.1| heavy metal transport/detoxification superfamily ... 56 8e-06 gb|KEH36986.1| heavy metal transport/detoxification superfamily ... 56 8e-06 gb|AFK43648.1| unknown [Medicago truncatula] gi|657397175|gb|KEH... 56 8e-06 >ref|XP_004486345.1| PREDICTED: FK506-binding protein 5-like [Cicer arietinum] Length = 270 Score = 60.1 bits (144), Expect = 6e-07 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP YY DYAYAP+IFSDENPNAC++M Sbjct: 242 EYWPSKYYVDYAYAPEIFSDENPNACSVM 270 >ref|XP_008785647.1| PREDICTED: FK506-binding protein 5-like [Phoenix dactylifera] Length = 271 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWPL Y +YAY PQIFSDENPNACTIM Sbjct: 243 EYWPLRYSVEYAYPPQIFSDENPNACTIM 271 >ref|XP_002308765.1| hypothetical protein POPTR_0006s00790g [Populus trichocarpa] gi|222854741|gb|EEE92288.1| hypothetical protein POPTR_0006s00790g [Populus trichocarpa] Length = 261 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP YY+++AYAPQIFSDENPNAC++M Sbjct: 233 EYWPSKYYSEFAYAPQIFSDENPNACSVM 261 >ref|XP_012849169.1| PREDICTED: neurofilament medium polypeptide-like isoform X2 [Erythranthe guttatus] Length = 279 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 277 LEYWPLAYYTDYAYAPQIFSDENPNACTIM 188 +EYWP YY D+AYAPQ+FSDENPNAC++M Sbjct: 250 MEYWPPKYYMDHAYAPQLFSDENPNACSLM 279 >ref|XP_012849168.1| PREDICTED: UPF0329 protein ECU05_1680/ECU11_0050-like isoform X1 [Erythranthe guttatus] Length = 280 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -3 Query: 277 LEYWPLAYYTDYAYAPQIFSDENPNACTIM 188 +EYWP YY D+AYAPQ+FSDENPNAC++M Sbjct: 251 MEYWPPKYYMDHAYAPQLFSDENPNACSLM 280 >ref|XP_004293397.1| PREDICTED: neurofilament medium polypeptide-like [Fragaria vesca subsp. vesca] Length = 260 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP +Y+DYAY PQIFSDENPNAC++M Sbjct: 232 EYWPSKHYSDYAYTPQIFSDENPNACSVM 260 >ref|XP_008790335.1| PREDICTED: UPF0329 protein ECU05_1680/ECU11_0050-like [Phoenix dactylifera] Length = 265 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP +Y +YAY PQIFSDENPNACT+M Sbjct: 237 EYWPSRFYVEYAYPPQIFSDENPNACTLM 265 >gb|KEH36987.1| heavy metal transport/detoxification superfamily protein [Medicago truncatula] Length = 229 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP Y DYAYAP+IFSDENPNAC++M Sbjct: 201 EYWPSKDYVDYAYAPEIFSDENPNACSVM 229 >gb|KEH36986.1| heavy metal transport/detoxification superfamily protein [Medicago truncatula] Length = 269 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP Y DYAYAP+IFSDENPNAC++M Sbjct: 241 EYWPSKDYVDYAYAPEIFSDENPNACSVM 269 >gb|AFK43648.1| unknown [Medicago truncatula] gi|657397175|gb|KEH36985.1| heavy metal transport/detoxification superfamily protein [Medicago truncatula] Length = 270 Score = 56.2 bits (134), Expect = 8e-06 Identities = 22/29 (75%), Positives = 25/29 (86%) Frame = -3 Query: 274 EYWPLAYYTDYAYAPQIFSDENPNACTIM 188 EYWP Y DYAYAP+IFSDENPNAC++M Sbjct: 242 EYWPSKDYVDYAYAPEIFSDENPNACSVM 270