BLASTX nr result
ID: Cinnamomum25_contig00011194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00011194 (738 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004766381.1| PREDICTED: submaxillary gland androgen-regul... 59 2e-06 >ref|XP_004766381.1| PREDICTED: submaxillary gland androgen-regulated protein 3A [Mustela putorius furo] Length = 257 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/56 (51%), Positives = 34/56 (60%) Frame = +3 Query: 108 PLPEDPWGRGRVPPLPKDP*GQGWMPLPLEDPYGRGRVPLPPSPGDVPEWMQPPAP 275 PLP P+G GR+PP P P G G +P PL PYG GR+P PP P P + PP P Sbjct: 64 PLPP-PYGPGRIPPPPLPPYGPGRIPPPLPPPYGPGRIPPPPPPPYGPGRIPPPLP 118