BLASTX nr result
ID: Cinnamomum25_contig00011192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00011192 (210 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409633.1| PREDICTED: translocon at the outer membrane ... 57 4e-06 gb|ABR18072.1| unknown [Picea sitchensis] 57 4e-06 >ref|XP_009409633.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 [Musa acuminata subsp. malaccensis] Length = 592 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 209 EAIEDFRYALVLEPTNKTANLAVNRLRKLFQ 117 EAIEDF+YALVLEPTNKTANLA NRL++LFQ Sbjct: 562 EAIEDFKYALVLEPTNKTANLASNRLKQLFQ 592 >gb|ABR18072.1| unknown [Picea sitchensis] Length = 274 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 209 EAIEDFRYALVLEPTNKTANLAVNRLRKLFQ 117 EAIEDF+YALVLEPTNK ANLA NRLRKLF+ Sbjct: 244 EAIEDFQYALVLEPTNKAANLAANRLRKLFE 274