BLASTX nr result
ID: Cinnamomum25_contig00011107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00011107 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009388675.1| PREDICTED: uncharacterized protein LOC103975... 57 5e-06 >ref|XP_009388675.1| PREDICTED: uncharacterized protein LOC103975436 [Musa acuminata subsp. malaccensis] Length = 177 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/60 (43%), Positives = 39/60 (65%) Frame = -1 Query: 187 QGSSAASSHGSDLFSFMPLLGILILTVTSIFSVIRARHDVPTLAFIISMYVFLMLLFYCL 8 Q S+ S + +F+++P + L LT S S R+RHD+PTLAFI+ YV L++L +CL Sbjct: 24 QAESSGPSSQTRVFNWLPTIAFLFLTYNSAESAYRSRHDIPTLAFIVFAYVDLVMLLFCL 83