BLASTX nr result
ID: Cinnamomum25_contig00010852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00010852 (577 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008810057.1| PREDICTED: LOW QUALITY PROTEIN: methionyl-tR... 56 1e-05 >ref|XP_008810057.1| PREDICTED: LOW QUALITY PROTEIN: methionyl-tRNA formyltransferase, mitochondrial [Phoenix dactylifera] Length = 413 Score = 56.2 bits (134), Expect = 1e-05 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 575 GCSALEVVEIQPPGKKVMNARDFWNGLRGRTLKKVSI 465 G S LEV+E+Q PGKKVM+ARDFWNGLRG+ L K+S+ Sbjct: 376 GPSWLEVLELQLPGKKVMSARDFWNGLRGQKLMKLSL 412