BLASTX nr result
ID: Cinnamomum25_contig00010538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00010538 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010908658.1| PREDICTED: pentatricopeptide repeat-containi... 120 4e-25 ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citr... 119 8e-25 ref|XP_009398362.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_008805381.1| PREDICTED: pentatricopeptide repeat-containi... 117 3e-24 gb|KDO60991.1| hypothetical protein CISIN_1g040319mg, partial [C... 117 4e-24 ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containi... 117 4e-24 ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containi... 116 5e-24 emb|CBI30210.3| unnamed protein product [Vitis vinifera] 116 5e-24 ref|XP_008241336.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_004305376.2| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 ref|XP_012468229.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-23 ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prun... 114 3e-23 ref|XP_008386565.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_007027561.1| Pentatricopeptide repeat (PPR) superfamily p... 110 3e-22 ref|XP_009378231.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 ref|XP_004955587.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 ref|XP_011012417.1| PREDICTED: pentatricopeptide repeat-containi... 109 6e-22 ref|XP_012082529.1| PREDICTED: pentatricopeptide repeat-containi... 109 6e-22 ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Popu... 109 8e-22 ref|XP_010543483.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 >ref|XP_010908658.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Elaeis guineensis] Length = 899 Score = 120 bits (301), Expect = 4e-25 Identities = 54/81 (66%), Positives = 69/81 (85%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 ++T SNSV +C+RLF SM S Y IEPT+EHYAAMVDVLG W F EA++LI+ MPFK +A Sbjct: 637 KYTSSNSVSTCQRLFCSMGSAYDIEPTSEHYAAMVDVLGFWGSFNEAKRLIKSMPFKADA 696 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 S+WRALLD+CRLRSN+S+G++ Sbjct: 697 SIWRALLDNCRLRSNLSLGRQ 717 >ref|XP_006430347.1| hypothetical protein CICLE_v10011036mg [Citrus clementina] gi|557532404|gb|ESR43587.1| hypothetical protein CICLE_v10011036mg [Citrus clementina] Length = 893 Score = 119 bits (298), Expect = 8e-25 Identities = 53/81 (65%), Positives = 67/81 (82%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 R+T SN VDSCR+LFLSM++ Y+IEPT+EHYA++V VLG W EEAE+ I +MPF+P Sbjct: 631 RYTNSNLVDSCRKLFLSMKTIYNIEPTSEHYASLVSVLGYWGFLEEAEETINNMPFQPKV 690 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCR+R N ++GKR Sbjct: 691 SVWRALLDSCRIRLNTTIGKR 711 >ref|XP_009398362.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Musa acuminata subsp. malaccensis] Length = 871 Score = 118 bits (295), Expect = 2e-24 Identities = 55/81 (67%), Positives = 68/81 (83%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 R+T SNSVD C LF SM S Y+I P +EHY+AMVDVLG W F+EAE+LI++MP KPNA Sbjct: 609 RYTSSNSVDVCHGLFHSMESSYNIIPASEHYSAMVDVLGYWGSFDEAEQLIKNMPSKPNA 668 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCRLRSN+++G++ Sbjct: 669 SVWRALLDSCRLRSNMTLGRQ 689 >ref|XP_008805381.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Phoenix dactylifera] Length = 892 Score = 117 bits (293), Expect = 3e-24 Identities = 52/81 (64%), Positives = 67/81 (82%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 ++T +NSV +C+RLF SM Y +EP +EHYAAMVDVLG W F+EAE+LI MPFK +A Sbjct: 630 KYTSTNSVSTCQRLFHSMGRAYDVEPASEHYAAMVDVLGFWGSFDEAERLINSMPFKADA 689 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 S+WRALLD+CRLRSN+S+GK+ Sbjct: 690 SIWRALLDNCRLRSNLSLGKQ 710 >gb|KDO60991.1| hypothetical protein CISIN_1g040319mg, partial [Citrus sinensis] Length = 812 Score = 117 bits (292), Expect = 4e-24 Identities = 52/81 (64%), Positives = 66/81 (81%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 R+T N VDSCR+LFLSM++ Y+IEPT+EHYA++V VLG W EEAE+ I +MPF+P Sbjct: 550 RYTNLNLVDSCRKLFLSMKTIYNIEPTSEHYASLVSVLGYWGFLEEAEETINNMPFQPKV 609 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCR+R N ++GKR Sbjct: 610 SVWRALLDSCRIRLNTTIGKR 630 >ref|XP_006481930.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800-like [Citrus sinensis] Length = 893 Score = 117 bits (292), Expect = 4e-24 Identities = 52/81 (64%), Positives = 66/81 (81%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 R+T N VDSCR+LFLSM++ Y+IEPT+EHYA++V VLG W EEAE+ I +MPF+P Sbjct: 631 RYTNLNLVDSCRKLFLSMKTIYNIEPTSEHYASLVSVLGYWGFLEEAEETINNMPFQPKV 690 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCR+R N ++GKR Sbjct: 691 SVWRALLDSCRIRLNTTIGKR 711 >ref|XP_002277923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Vitis vinifera] Length = 882 Score = 116 bits (291), Expect = 5e-24 Identities = 51/81 (62%), Positives = 64/81 (79%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD+CRRLFLSM++ Y I+PT EHY ++V VLG W EEAE++I MP +P A Sbjct: 620 RHTNSNLVDNCRRLFLSMKTIYHIDPTVEHYTSLVGVLGYWGLLEEAEEMINKMPIEPEA 679 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLD+CR+ SN ++GKR Sbjct: 680 SVWRALLDACRIHSNTTIGKR 700 >emb|CBI30210.3| unnamed protein product [Vitis vinifera] Length = 900 Score = 116 bits (291), Expect = 5e-24 Identities = 51/81 (62%), Positives = 64/81 (79%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD+CRRLFLSM++ Y I+PT EHY ++V VLG W EEAE++I MP +P A Sbjct: 638 RHTNSNLVDNCRRLFLSMKTIYHIDPTVEHYTSLVGVLGYWGLLEEAEEMINKMPIEPEA 697 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLD+CR+ SN ++GKR Sbjct: 698 SVWRALLDACRIHSNTTIGKR 718 >ref|XP_008241336.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Prunus mume] Length = 905 Score = 115 bits (287), Expect = 1e-23 Identities = 52/81 (64%), Positives = 64/81 (79%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD+CR LFLSM++ Y IEPT+EH+A+ + VLG W +EAE++I MPF+P Sbjct: 643 RHTNSNLVDNCRSLFLSMKTVYGIEPTSEHFASFIAVLGYWGLLDEAEEIICKMPFEPEV 702 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCRLR N +VGKR Sbjct: 703 SVWRALLDSCRLRMNTTVGKR 723 >ref|XP_004305376.2| PREDICTED: pentatricopeptide repeat-containing protein At5g03800, partial [Fragaria vesca subsp. vesca] Length = 838 Score = 114 bits (285), Expect = 3e-23 Identities = 51/81 (62%), Positives = 62/81 (76%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT S+SVD+CR LFLSM++ Y I+PT EH+A+ + VLG W +EAE I MPFKP Sbjct: 576 RHTNSSSVDNCRSLFLSMKAVYDIDPTPEHFASFIGVLGYWGLLDEAEDTISKMPFKPEV 635 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCR+R N +VGKR Sbjct: 636 SVWRALLDSCRIRMNTAVGKR 656 >ref|XP_012468229.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Gossypium raimondii] gi|763749279|gb|KJB16718.1| hypothetical protein B456_002G244700 [Gossypium raimondii] Length = 885 Score = 114 bits (284), Expect = 3e-23 Identities = 51/81 (62%), Positives = 64/81 (79%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT + VD CR+LFLSMR+ Y IEPT++H+A+ V VLG W EEAE+ IE+MP +P A Sbjct: 623 RHTNLDLVDDCRKLFLSMRTDYDIEPTSQHHASFVSVLGQWGLLEEAEETIENMPVEPKA 682 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCR+R N ++GKR Sbjct: 683 SVWRALLDSCRIRLNTTIGKR 703 >ref|XP_007203128.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] gi|462398659|gb|EMJ04327.1| hypothetical protein PRUPE_ppa024044mg [Prunus persica] Length = 905 Score = 114 bits (284), Expect = 3e-23 Identities = 51/81 (62%), Positives = 64/81 (79%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD+CR LFLS+++ Y IEPT+EH+A+ + VLG W +EAE++I MPF+P Sbjct: 643 RHTNSNLVDNCRSLFLSLKTVYGIEPTSEHFASFIAVLGYWGLLDEAEEIICKMPFEPEV 702 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLDSCRLR N +VGKR Sbjct: 703 SVWRALLDSCRLRMNTTVGKR 723 >ref|XP_008386565.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Malus domestica] gi|657988770|ref|XP_008386567.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Malus domestica] Length = 905 Score = 110 bits (276), Expect = 3e-22 Identities = 49/81 (60%), Positives = 63/81 (77%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD+CR LFLSM++ Y IEPT+EH+A+ V VLG W +EAE+ I MPF+P Sbjct: 644 RHTTSNLVDACRSLFLSMKTVYDIEPTSEHFASFVGVLGYWGLLDEAEETISKMPFEPEF 703 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 VWRALLDSCR+++N ++GKR Sbjct: 704 IVWRALLDSCRIQTNTTIGKR 724 >ref|XP_007027561.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508716166|gb|EOY08063.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 876 Score = 110 bits (276), Expect = 3e-22 Identities = 49/81 (60%), Positives = 64/81 (79%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT S+ VD+CR+LFLSM++ Y+IEPT +HYA+ V VLG W+ EEAEK+I+ M +P A Sbjct: 614 RHTNSDLVDNCRKLFLSMKTNYNIEPTPQHYASFVSVLGRWSLLEEAEKMIDKMTAEPKA 673 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 S WRALLDSCR+ N ++GKR Sbjct: 674 SAWRALLDSCRIHLNTTIGKR 694 >ref|XP_009378231.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Pyrus x bretschneideri] Length = 906 Score = 110 bits (275), Expect = 4e-22 Identities = 49/81 (60%), Positives = 62/81 (76%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD CR LFLSM++ Y IEPT+EH+A+ V VLG W +EAE+ I MPF+P Sbjct: 644 RHTTSNLVDDCRSLFLSMKTVYDIEPTSEHFASFVGVLGYWGLLDEAEETISKMPFEPEF 703 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 VWRALLDSCR+++N ++GKR Sbjct: 704 IVWRALLDSCRIQTNTTIGKR 724 >ref|XP_004955587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Setaria italica] Length = 867 Score = 110 bits (275), Expect = 4e-22 Identities = 52/80 (65%), Positives = 60/80 (75%) Frame = -2 Query: 242 HTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNAS 63 HT S+S D CR LFLSM S Y IEP EHYAA V+VLG W F+EAE+LI MPFKP A Sbjct: 608 HTSSDSTDQCRELFLSMSSSYGIEPAMEHYAAFVNVLGCWGHFDEAEQLIGSMPFKPGAL 667 Query: 62 VWRALLDSCRLRSNVSVGKR 3 VWR+LLDSC RSN++V +R Sbjct: 668 VWRSLLDSCSKRSNMTVRRR 687 >ref|XP_011012417.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Populus euphratica] Length = 915 Score = 109 bits (273), Expect = 6e-22 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 ++T SN +D CR +FLSM+ + +EPT+EHYA++V VLG W EEAE+LI MPF P Sbjct: 653 KYTSSNLLDECRSMFLSMKMIHDLEPTSEHYASLVGVLGYWGLLEEAEELINKMPFDPEV 712 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLD CRL +N S+GKR Sbjct: 713 SVWRALLDGCRLHANTSIGKR 733 >ref|XP_012082529.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Jatropha curcas] gi|643717786|gb|KDP29229.1| hypothetical protein JCGZ_16618 [Jatropha curcas] Length = 887 Score = 109 bits (273), Expect = 6e-22 Identities = 49/81 (60%), Positives = 61/81 (75%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 RHT SN VD CR LFLSM+ Y ++PT+EHYA++V VLG W EEAE++I MPF+P A Sbjct: 624 RHTNSNLVDDCRNLFLSMKKAYEVDPTSEHYASLVSVLGYWGLLEEAEEMIIKMPFEPEA 683 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 VWRALL+SCR N+S+G R Sbjct: 684 FVWRALLESCRYHLNMSMGLR 704 >ref|XP_002323489.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] gi|550321242|gb|EEF05250.2| hypothetical protein POPTR_0016s11000g [Populus trichocarpa] Length = 915 Score = 109 bits (272), Expect = 8e-22 Identities = 49/81 (60%), Positives = 60/81 (74%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 + T SN +D CR LFLSM+ + +EPT+EHYA++V VLG W EEAE+LI MPF P Sbjct: 653 KFTSSNLLDECRSLFLSMKMIHDLEPTSEHYASLVGVLGYWGLLEEAEELINKMPFDPEV 712 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SVWRALLD CRL +N S+GKR Sbjct: 713 SVWRALLDGCRLHANTSIGKR 733 >ref|XP_010543483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Tarenaya hassleriana] Length = 894 Score = 108 bits (270), Expect = 1e-21 Identities = 51/81 (62%), Positives = 62/81 (76%) Frame = -2 Query: 245 RHTKSNSVDSCRRLFLSMRSCYSIEPTAEHYAAMVDVLGSWNCFEEAEKLIEDMPFKPNA 66 R+T+SN V SCR LFLSM++ YSIEPT+EHY A V VLG W EEAE+ I+ MPF+P Sbjct: 632 RYTESNLVSSCRDLFLSMKTTYSIEPTSEHYTAFVGVLGHWGFLEEAEETIKSMPFEPEV 691 Query: 65 SVWRALLDSCRLRSNVSVGKR 3 SV +ALLDSCR+ SN S+ KR Sbjct: 692 SVLKALLDSCRVHSNTSIAKR 712