BLASTX nr result
ID: Cinnamomum25_contig00009409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00009409 (634 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsic... 110 5e-22 gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 86 1e-14 ref|XP_010087758.1| hypothetical protein L484_008955 [Morus nota... 79 1e-12 ref|YP_588321.1| hypothetical protein ZeamMp058 [Zea mays subsp.... 79 2e-12 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] 70 1e-09 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 46 2e-08 ref|XP_010313185.1| PREDICTED: uncharacterized protein LOC101264... 61 4e-07 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >ref|YP_009049820.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751809|gb|AIG89896.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752092|gb|AIG90178.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 102 Score = 110 bits (276), Expect = 5e-22 Identities = 48/55 (87%), Positives = 51/55 (92%) Frame = +3 Query: 3 GASIHQRRLQVLSEPCWIVTHHTALKPNLWWIPGDKVKALDPLPHTLRCSSPPIK 167 GASIHQRRL+VLSEPCWIVTHHTALKPNLWWIPGDKVK PLPHTLRCSSP ++ Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPGDKVKTQHPLPHTLRCSSPVLR 71 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 86.3 bits (212), Expect = 1e-14 Identities = 41/45 (91%), Positives = 41/45 (91%) Frame = -3 Query: 137 MGQRIKRFDFVPRDPPQVGFESRVMGDYPARFGEHL*SALVNGSP 3 MGQRIKRFDFV RD PQVGFESRVMGDYPARFGEH SALVNGSP Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSP 45 >ref|XP_010087758.1| hypothetical protein L484_008955 [Morus notabilis] gi|587839116|gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 79.3 bits (194), Expect = 1e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 GASIHQRRLQVLSEPCWIVTHHTALKPNLWWIPGDKV 113 GASIHQRRL+VLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 >ref|YP_588321.1| hypothetical protein ZeamMp058 [Zea mays subsp. mays] gi|40795110|gb|AAR91154.1| hypothetical protein (mitochondrion) [Zea mays] gi|413954039|gb|AFW86688.1| putative uncharacterized protein orf109-a [Zea mays] gi|413954253|gb|AFW86902.1| putative uncharacterized protein orf109-a [Zea mays] gi|414888179|tpg|DAA64193.1| TPA: putative uncharacterized protein orf109-a [Zea mays] Length = 109 Score = 79.0 bits (193), Expect = 2e-12 Identities = 45/81 (55%), Positives = 46/81 (56%) Frame = +1 Query: 391 MSITHLRLVRTEGQCPPNLT*VGLPAKQRVLDRAGGGLVSCNAPAAGRGGCHLKGNVPTP 570 MSITHLRLVRTEGQCPP A QR G P PTP Sbjct: 1 MSITHLRLVRTEGQCPPRR------AHQRSNCYLIGRFAFVQGPRCWNRRLSFSSKRPTP 54 Query: 571 EGRPRSLGKTLRKKNVSPRPR 633 EGRPRS+GKTLRKKNVSPRPR Sbjct: 55 EGRPRSIGKTLRKKNVSPRPR 75 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 137 MGQRIKRFDFVPRDPPQVGFESRVMGDYPARFGE 36 MGQRIKRFDFV RD PQVGFESRVMGDYPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 46.2 bits (108), Expect(2) = 2e-08 Identities = 22/28 (78%), Positives = 24/28 (85%), Gaps = 2/28 (7%) Frame = +1 Query: 253 WSS--LIFPNVQSCSGLRKEHRPSALNE 330 WSS + FPNV+SCSGLRKEHRPS LNE Sbjct: 36 WSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 39.7 bits (91), Expect(2) = 2e-08 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = +3 Query: 198 KPLTFGSDKSSPFGRFARV 254 KPL+FGSDKSSPFGRFA+V Sbjct: 16 KPLSFGSDKSSPFGRFAQV 34 >ref|XP_010313185.1| PREDICTED: uncharacterized protein LOC101264997, partial [Solanum lycopersicum] Length = 294 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 137 MGQRIKRFDFVPRDPPQVGFESRVMGDYPAR 45 MGQR+ RFDFV RDPPQVGF+SRVMGDYPAR Sbjct: 1 MGQRMLRFDFVSRDPPQVGFQSRVMGDYPAR 31 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.2 bits (139), Expect = 3e-06 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 3 GASIHQRRLQVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPPIK 167 G SI Q RL+VL EPC I+T++T GD VKALDPLPHTL+ SS PIK Sbjct: 17 GPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72