BLASTX nr result
ID: Cinnamomum25_contig00009028
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00009028 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007580216.1| putative chaperone heat shock protein hsp12 ... 96 7e-18 ref|XP_001936138.1| conserved hypothetical protein [Pyrenophora ... 95 2e-17 gb|KKY22411.1| putative heat shock protein awh11 [Diplodia seriata] 94 3e-17 ref|XP_008021774.1| hypothetical protein SETTUDRAFT_166944 [Seto... 92 1e-16 ref|XP_003298857.1| hypothetical protein PTT_09685 [Pyrenophora ... 91 2e-16 gb|EKG17948.1| Heat shock protein 9/12 [Macrophomina phaseolina ... 91 4e-16 ref|XP_007781705.1| hypothetical protein W97_05485 [Coniosporium... 90 7e-16 ref|XP_001805759.1| hypothetical protein SNOG_15614 [Phaeosphaer... 87 3e-15 gb|KIV90989.1| hypothetical protein PV10_05583 [Exophiala mesoph... 87 4e-15 ref|XP_003836375.1| similar to chaperone/heat shock protein Hsp1... 87 4e-15 ref|XP_007690273.1| hypothetical protein COCMIDRAFT_101410 [Bipo... 86 1e-14 ref|XP_007731788.1| hypothetical protein A1O3_03460 [Capronia ep... 85 2e-14 ref|XP_007694552.1| hypothetical protein COCSADRAFT_75737 [Bipol... 85 2e-14 ref|XP_009157919.1| hypothetical protein HMPREF1120_05492 [Exoph... 85 2e-14 gb|KIX98080.1| hypothetical protein Z520_06160 [Fonsecaea multim... 84 3e-14 gb|KIW27093.1| hypothetical protein PV07_06869 [Cladophialophora... 84 5e-14 ref|XP_007706658.1| hypothetical protein COCCADRAFT_447 [Bipolar... 84 5e-14 gb|EMD96136.1| hypothetical protein COCHEDRAFT_1167047 [Bipolari... 83 6e-14 ref|XP_007743392.1| hypothetical protein A1O5_04598 [Cladophialo... 83 8e-14 gb|KIW97034.1| hypothetical protein Z519_02426 [Cladophialophora... 82 1e-13 >ref|XP_007580216.1| putative chaperone heat shock protein hsp12 protein [Neofusicoccum parvum UCRNP2] gi|485928653|gb|EOD52325.1| putative chaperone heat shock protein hsp12 protein [Neofusicoccum parvum UCRNP2] Length = 99 Score = 96.3 bits (238), Expect = 7e-18 Identities = 47/63 (74%), Positives = 52/63 (82%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD GRKG+ DQAQEK+TPDSQKSTLDQAKES +G YDRAAGA QP D KS +QK D+ Sbjct: 1 MSDAGRKGVLDQAQEKITPDSQKSTLDQAKESITGTYDRAAGAAQPSDTKSTSQKAADSV 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >ref|XP_001936138.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983237|gb|EDU48725.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 97 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/63 (73%), Positives = 54/63 (85%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QAQEK+TPDSQKST+D+A ES +GA DR AGA+QP+ QKSA QK+GD T Sbjct: 1 MSDSMRKGLGEQAQEKITPDSQKSTMDKASESLTGAGDRVAGAVQPEGQKSAGQKVGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >gb|KKY22411.1| putative heat shock protein awh11 [Diplodia seriata] Length = 97 Score = 94.4 bits (233), Expect = 3e-17 Identities = 47/63 (74%), Positives = 49/63 (77%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RK DQAQEK+TPDSQKSTLDQAKES SG YDRAAGA QPD QKS TQK D+ Sbjct: 1 MSDAARKSTLDQAQEKITPDSQKSTLDQAKESISGTYDRAAGAAQPDSQKSTTQKASDSV 60 Query: 9 RSG 1 R G Sbjct: 61 RGG 63 >ref|XP_008021774.1| hypothetical protein SETTUDRAFT_166944 [Setosphaeria turcica Et28A] gi|482814464|gb|EOA91142.1| hypothetical protein SETTUDRAFT_166944 [Setosphaeria turcica Et28A] Length = 99 Score = 92.4 bits (228), Expect = 1e-16 Identities = 45/63 (71%), Positives = 53/63 (84%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QA EK+TPDSQKST ++A E+ +GA DR AG+LQPDDQKSA QK+GD T Sbjct: 1 MSDSMRKGLGEQASEKITPDSQKSTTEKASENLTGAGDRIAGSLQPDDQKSAGQKLGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >ref|XP_003298857.1| hypothetical protein PTT_09685 [Pyrenophora teres f. teres 0-1] gi|311327758|gb|EFQ93044.1| hypothetical protein PTT_09685 [Pyrenophora teres f. teres 0-1] Length = 97 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QAQEK+TPDSQKST+D+A ES +GA DR AG +QP+ QKS QK+GD T Sbjct: 1 MSDSMRKGLGEQAQEKMTPDSQKSTMDKASESLTGAGDRIAGTMQPEGQKSTGQKLGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >gb|EKG17948.1| Heat shock protein 9/12 [Macrophomina phaseolina MS6] Length = 128 Score = 90.5 bits (223), Expect = 4e-16 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = -2 Query: 174 RKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTTRSG 1 RK + DQAQEK+TPDSQKSTLD+A ES SG YDRAAGALQPDDQKSATQK D+ R G Sbjct: 35 RKSVLDQAQEKVTPDSQKSTLDKAGESLSGTYDRAAGALQPDDQKSATQKASDSLRGG 92 >ref|XP_007781705.1| hypothetical protein W97_05485 [Coniosporium apollinis CBS 100218] gi|494829807|gb|EON66388.1| hypothetical protein W97_05485 [Coniosporium apollinis CBS 100218] Length = 100 Score = 89.7 bits (221), Expect = 7e-16 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD+GRK +GDQ +K+TPDSQKSTLDQAKES SGA DR A A+QP+ KSATQK D+ Sbjct: 1 MSDMGRKSVGDQISDKVTPDSQKSTLDQAKESVSGAGDRVASAVQPEGDKSATQKASDSV 60 Query: 9 RSG 1 R G Sbjct: 61 RGG 63 >ref|XP_001805759.1| hypothetical protein SNOG_15614 [Phaeosphaeria nodorum SN15] gi|111055869|gb|EAT76989.1| hypothetical protein SNOG_15614 [Phaeosphaeria nodorum SN15] Length = 101 Score = 87.4 bits (215), Expect = 3e-15 Identities = 43/63 (68%), Positives = 51/63 (80%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QAQEK+TPDSQKST +A E ASG D+ A A+QP+ QKS TQK+GD+T Sbjct: 1 MSDSMRKGLGEQAQEKITPDSQKSTGQKASEGASGLGDKVASAVQPEGQKSTTQKLGDST 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >gb|KIV90989.1| hypothetical protein PV10_05583 [Exophiala mesophila] Length = 217 Score = 87.0 bits (214), Expect = 4e-15 Identities = 44/62 (70%), Positives = 49/62 (79%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSDLGRK L DQAQEKLTPDSQKSTLD+A ES +GA D AGA+QP D KS +QK+ D T Sbjct: 80 MSDLGRKPLTDQAQEKLTPDSQKSTLDKATESVTGAADNIAGAVQPGDSKSTSQKLADET 139 Query: 9 RS 4 S Sbjct: 140 TS 141 >ref|XP_003836375.1| similar to chaperone/heat shock protein Hsp12 [Leptosphaeria maculans JN3] gi|312212928|emb|CBX93010.1| similar to chaperone/heat shock protein Hsp12 [Leptosphaeria maculans JN3] Length = 98 Score = 87.0 bits (214), Expect = 4e-15 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QAQEK+TPDSQKST +A E+ SG D+ AGA+QP+ KSATQK GD T Sbjct: 1 MSDNLRKGLGEQAQEKITPDSQKSTTQKASENVSGLGDKVAGAVQPEGNKSATQKAGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >ref|XP_007690273.1| hypothetical protein COCMIDRAFT_101410 [Bipolaris oryzae ATCC 44560] gi|576929595|gb|EUC43199.1| hypothetical protein COCMIDRAFT_101410 [Bipolaris oryzae ATCC 44560] Length = 99 Score = 85.9 bits (211), Expect = 1e-14 Identities = 44/63 (69%), Positives = 50/63 (79%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QA EKL PDS KST ++A E+ SGA DR AGALQP+ QKSA QK+GD T Sbjct: 1 MSDSMRKGLGEQAGEKLQPDSTKSTTEKASENISGAGDRIAGALQPEGQKSAGQKLGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >ref|XP_007731788.1| hypothetical protein A1O3_03460 [Capronia epimyces CBS 606.96] gi|590011305|gb|EXJ86509.1| hypothetical protein A1O3_03460 [Capronia epimyces CBS 606.96] Length = 207 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/62 (66%), Positives = 47/62 (75%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD GRK L DQ Q+K+TPDSQKST DQAK+SA+G D AG +QP D KS TQK+ D T Sbjct: 1 MSDTGRKPLTDQVQQKITPDSQKSTFDQAKDSATGTADSVAGLVQPGDSKSTTQKLSDET 60 Query: 9 RS 4 RS Sbjct: 61 RS 62 >ref|XP_007694552.1| hypothetical protein COCSADRAFT_75737 [Bipolaris sorokiniana ND90Pr] gi|451855845|gb|EMD69136.1| hypothetical protein COCSADRAFT_75737 [Bipolaris sorokiniana ND90Pr] Length = 99 Score = 84.7 bits (208), Expect = 2e-14 Identities = 43/63 (68%), Positives = 49/63 (77%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QA EKL PDS KS ++A ES SGA DR AGA+QP+ QKSA QK+GD T Sbjct: 1 MSDSMRKGLGEQASEKLQPDSTKSNTEKASESLSGAGDRIAGAVQPEGQKSAGQKLGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >ref|XP_009157919.1| hypothetical protein HMPREF1120_05492 [Exophiala dermatitidis NIH/UT8656] gi|378730999|gb|EHY57458.1| hypothetical protein HMPREF1120_05492 [Exophiala dermatitidis NIH/UT8656] Length = 236 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/62 (66%), Positives = 46/62 (74%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD GRK L DQ Q+K+TPDSQKST D+ KESASG D AG +QP D KS TQK+ D T Sbjct: 1 MSDTGRKDLTDQVQQKITPDSQKSTFDKTKESASGTADNVAGLVQPGDSKSTTQKLSDET 60 Query: 9 RS 4 RS Sbjct: 61 RS 62 >gb|KIX98080.1| hypothetical protein Z520_06160 [Fonsecaea multimorphosa CBS 102226] Length = 145 Score = 84.3 bits (207), Expect = 3e-14 Identities = 42/60 (70%), Positives = 46/60 (76%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD GRK L DQAQEK+TPDSQKST DQAKESA+G D AG +QP D KS TQK+ D T Sbjct: 1 MSDTGRKPLTDQAQEKITPDSQKSTFDQAKESATGTADDIAGMVQPGDSKSTTQKLSDET 60 >gb|KIW27093.1| hypothetical protein PV07_06869 [Cladophialophora immunda] Length = 163 Score = 83.6 bits (205), Expect = 5e-14 Identities = 42/60 (70%), Positives = 46/60 (76%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD GRK L DQAQEKLTPDSQKST D+AKESA+G D AG +QP D KS TQK+ D T Sbjct: 1 MSDTGRKPLTDQAQEKLTPDSQKSTFDKAKESATGTADDIAGMVQPGDSKSTTQKLSDET 60 >ref|XP_007706658.1| hypothetical protein COCCADRAFT_447 [Bipolaris zeicola 26-R-13] gi|576924936|gb|EUC39043.1| hypothetical protein COCCADRAFT_447 [Bipolaris zeicola 26-R-13] gi|578492540|gb|EUN29939.1| hypothetical protein COCVIDRAFT_24213 [Bipolaris victoriae FI3] Length = 99 Score = 83.6 bits (205), Expect = 5e-14 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QA EKL PDS KS ++A E+ SGA DR AGA+QP+ QKSA QK+GD T Sbjct: 1 MSDSMRKGLGEQASEKLQPDSTKSNTEKASETLSGAGDRIAGAVQPEGQKSAGQKLGDAT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >gb|EMD96136.1| hypothetical protein COCHEDRAFT_1167047 [Bipolaris maydis C5] gi|477593926|gb|ENI10995.1| hypothetical protein COCC4DRAFT_184352 [Bipolaris maydis ATCC 48331] Length = 99 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/63 (66%), Positives = 49/63 (77%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD RKGLG+QA EKL PDS KS ++A ES SGA DR AG++QP+ QKSA QK+GD T Sbjct: 1 MSDSMRKGLGEQASEKLQPDSTKSNTEKASESLSGAGDRLAGSVQPEGQKSAGQKLGDMT 60 Query: 9 RSG 1 RSG Sbjct: 61 RSG 63 >ref|XP_007743392.1| hypothetical protein A1O5_04598 [Cladophialophora psammophila CBS 110553] gi|589989336|gb|EXJ72094.1| hypothetical protein A1O5_04598 [Cladophialophora psammophila CBS 110553] Length = 163 Score = 82.8 bits (203), Expect = 8e-14 Identities = 41/60 (68%), Positives = 46/60 (76%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGDTT 10 MSD GRK L DQAQEK+TPDSQKSTLD+ KESA+G D AG +QP D KS TQK+ D T Sbjct: 1 MSDTGRKPLIDQAQEKITPDSQKSTLDKTKESATGTADNIAGMVQPGDSKSTTQKLSDET 60 >gb|KIW97034.1| hypothetical protein Z519_02426 [Cladophialophora bantiana CBS 173.52] Length = 134 Score = 82.4 bits (202), Expect = 1e-13 Identities = 41/58 (70%), Positives = 46/58 (79%) Frame = -2 Query: 189 MSDLGRKGLGDQAQEKLTPDSQKSTLDQAKESASGAYDRAAGALQPDDQKSATQKIGD 16 MSD GRK L DQAQEK+TPDSQKSTLD+AKESA+G D AG +QP D KS TQK+ D Sbjct: 1 MSDTGRKPLMDQAQEKITPDSQKSTLDKAKESATGTADDIAGMVQPGDSKSTTQKLSD 58