BLASTX nr result
ID: Cinnamomum25_contig00007420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00007420 (217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO68019.1| hypothetical protein CISIN_1g015543mg [Citrus sin... 81 2e-13 ref|XP_006486759.1| PREDICTED: 26S proteasome non-ATPase regulat... 81 2e-13 ref|XP_006422625.1| hypothetical protein CICLE_v10028565mg [Citr... 81 2e-13 ref|XP_006422624.1| hypothetical protein CICLE_v10028565mg [Citr... 81 2e-13 ref|XP_010246840.1| PREDICTED: 26S proteasome non-ATPase regulat... 81 3e-13 ref|XP_006340751.1| PREDICTED: 26S proteasome non-ATPase regulat... 79 9e-13 ref|XP_006340749.1| PREDICTED: 26S proteasome non-ATPase regulat... 79 9e-13 ref|XP_010266804.1| PREDICTED: 26S proteasome non-ATPase regulat... 79 2e-12 ref|XP_006846550.1| PREDICTED: 26S proteasome non-ATPase regulat... 79 2e-12 ref|XP_009614510.1| PREDICTED: 26S proteasome non-ATPase regulat... 78 2e-12 ref|XP_009614509.1| PREDICTED: 26S proteasome non-ATPase regulat... 78 2e-12 ref|XP_009783181.1| PREDICTED: 26S proteasome non-ATPase regulat... 78 3e-12 ref|XP_009783179.1| PREDICTED: 26S proteasome non-ATPase regulat... 78 3e-12 ref|XP_009783177.1| PREDICTED: 26S proteasome non-ATPase regulat... 78 3e-12 ref|XP_009770180.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 3e-12 ref|XP_009591888.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 3e-12 ref|XP_011099844.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 4e-12 ref|XP_011099843.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 4e-12 ref|XP_010316429.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 4e-12 ref|XP_010316428.1| PREDICTED: 26S proteasome non-ATPase regulat... 77 4e-12 >gb|KDO68019.1| hypothetical protein CISIN_1g015543mg [Citrus sinensis] Length = 392 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ+DM+KVLGDQSFVSSIL SLPGVDPNDPSVKDL+ASLQGQ Sbjct: 343 DPSNQSDMSKVLGDQSFVSSILTSLPGVDPNDPSVKDLIASLQGQ 387 >ref|XP_006486759.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Citrus sinensis] gi|641849143|gb|KDO68018.1| hypothetical protein CISIN_1g015543mg [Citrus sinensis] Length = 405 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ+DM+KVLGDQSFVSSIL SLPGVDPNDPSVKDL+ASLQGQ Sbjct: 343 DPSNQSDMSKVLGDQSFVSSILTSLPGVDPNDPSVKDLIASLQGQ 387 >ref|XP_006422625.1| hypothetical protein CICLE_v10028565mg [Citrus clementina] gi|557524559|gb|ESR35865.1| hypothetical protein CICLE_v10028565mg [Citrus clementina] Length = 405 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ+DM+KVLGDQSFVSSIL SLPGVDPNDPSVKDL+ASLQGQ Sbjct: 343 DPSNQSDMSKVLGDQSFVSSILTSLPGVDPNDPSVKDLIASLQGQ 387 >ref|XP_006422624.1| hypothetical protein CICLE_v10028565mg [Citrus clementina] gi|557524558|gb|ESR35864.1| hypothetical protein CICLE_v10028565mg [Citrus clementina] Length = 392 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ+DM+KVLGDQSFVSSIL SLPGVDPNDPSVKDL+ASLQGQ Sbjct: 343 DPSNQSDMSKVLGDQSFVSSILTSLPGVDPNDPSVKDLIASLQGQ 387 >ref|XP_010246840.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nelumbo nucifera] Length = 404 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + ++Q +MNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ Sbjct: 344 DSASQTEMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 388 >ref|XP_006340751.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Solanum tuberosum] Length = 403 Score = 79.3 bits (194), Expect = 9e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ DM+K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 342 DQSNQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 386 >ref|XP_006340749.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Solanum tuberosum] gi|565347473|ref|XP_006340750.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Solanum tuberosum] Length = 404 Score = 79.3 bits (194), Expect = 9e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ DM+K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 342 DQSNQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 386 >ref|XP_010266804.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nelumbo nucifera] Length = 404 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + ++Q +M KVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ Sbjct: 342 DSASQTEMTKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 386 >ref|XP_006846550.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Amborella trichopoda] gi|548849360|gb|ERN08225.1| hypothetical protein AMTR_s00018p00211530 [Amborella trichopoda] Length = 406 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + S+Q DM+KVLGDQ+FVSSIL SLPGVDPNDPSVKDLLASLQGQ Sbjct: 347 DSSSQTDMSKVLGDQTFVSSILKSLPGVDPNDPSVKDLLASLQGQ 391 >ref|XP_009614510.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Nicotiana tomentosiformis] Length = 399 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 +DSNQ D+ K+L DQSFVSSILASLPGVDPNDPSVK+LLAS+QGQ Sbjct: 341 DDSNQTDVTKLLADQSFVSSILASLPGVDPNDPSVKELLASMQGQ 385 >ref|XP_009614509.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Nicotiana tomentosiformis] Length = 400 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 +DSNQ D+ K+L DQSFVSSILASLPGVDPNDPSVK+LLAS+QGQ Sbjct: 341 DDSNQTDVTKLLADQSFVSSILASLPGVDPNDPSVKELLASMQGQ 385 >ref|XP_009783181.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Nicotiana sylvestris] gi|698467662|ref|XP_009783182.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X3 [Nicotiana sylvestris] Length = 399 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 +DS+Q D+ K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 341 DDSDQTDVTKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 385 >ref|XP_009783179.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Nicotiana sylvestris] gi|698467652|ref|XP_009783180.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Nicotiana sylvestris] Length = 400 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 +DS+Q D+ K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 341 DDSDQTDVTKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 385 >ref|XP_009783177.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Nicotiana sylvestris] gi|698467644|ref|XP_009783178.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Nicotiana sylvestris] Length = 411 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 +DS+Q D+ K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 341 DDSDQTDVTKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 385 >ref|XP_009770180.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nicotiana sylvestris] Length = 400 Score = 77.4 bits (189), Expect = 3e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + S+Q DM+K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 339 DQSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 383 >ref|XP_009591888.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog [Nicotiana tomentosiformis] Length = 400 Score = 77.4 bits (189), Expect = 3e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + S+Q DM+K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 339 DQSSQTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 383 >ref|XP_011099844.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Sesamum indicum] Length = 402 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ DMNK+L DQSFVSSILASLPGVDPNDP VKDLLAS+Q Q Sbjct: 342 DQSNQTDMNKLLADQSFVSSILASLPGVDPNDPHVKDLLASMQSQ 386 >ref|XP_011099843.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Sesamum indicum] Length = 403 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SNQ DMNK+L DQSFVSSILASLPGVDPNDP VKDLLAS+Q Q Sbjct: 342 DQSNQTDMNKLLADQSFVSSILASLPGVDPNDPHVKDLLASMQSQ 386 >ref|XP_010316429.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X2 [Solanum lycopersicum] Length = 403 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SN DM+K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 342 DQSNPTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 386 >ref|XP_010316428.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 4 homolog isoform X1 [Solanum lycopersicum] Length = 404 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 1 EDSNQNDMNKVLGDQSFVSSILASLPGVDPNDPSVKDLLASLQGQ 135 + SN DM+K+L DQSFVSSILASLPGVDPNDPSVKDLLAS+QGQ Sbjct: 342 DQSNPTDMSKLLADQSFVSSILASLPGVDPNDPSVKDLLASMQGQ 386