BLASTX nr result
ID: Cinnamomum25_contig00007142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cinnamomum25_contig00007142 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001168135.1| uncharacterized protein LOC100381882 [Zea ma... 82 1e-13 ref|XP_004975505.1| PREDICTED: 50S ribosomal protein L19, chloro... 82 1e-13 gb|AFW61421.1| hypothetical protein ZEAMMB73_090575 [Zea mays] 82 1e-13 ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] g... 81 2e-13 ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloro... 81 3e-13 ref|XP_004956363.1| PREDICTED: 50S ribosomal protein L19, chloro... 81 3e-13 gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilop... 81 3e-13 gb|EMS56595.1| 50S ribosomal protein L19, chloroplastic [Triticu... 81 3e-13 gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticu... 81 3e-13 ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloro... 81 3e-13 dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgar... 81 3e-13 ref|XP_003563681.1| PREDICTED: 50S ribosomal protein L19, chloro... 80 4e-13 ref|XP_008648368.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 80 5e-13 ref|XP_010276951.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 79 2e-12 ref|XP_010260779.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 79 2e-12 ref|XP_002318674.2| hypothetical protein POPTR_0012s08870g [Popu... 79 2e-12 ref|XP_012468707.1| PREDICTED: 50S ribosomal protein L19-1, chlo... 78 2e-12 gb|KJB08093.1| hypothetical protein B456_001G064300 [Gossypium r... 78 2e-12 ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus... 78 3e-12 ref|XP_002444908.1| hypothetical protein SORBIDRAFT_07g001190 [S... 78 3e-12 >ref|NP_001168135.1| uncharacterized protein LOC100381882 [Zea mays] gi|670394216|ref|XP_008677536.1| PREDICTED: uncharacterized protein LOC100381882 isoform X1 [Zea mays] gi|223946231|gb|ACN27199.1| unknown [Zea mays] gi|413921488|gb|AFW61420.1| hypothetical protein ZEAMMB73_090575 [Zea mays] Length = 238 Score = 82.4 bits (202), Expect = 1e-13 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIKVLD R KVRRAKLY+LR+RMNALRK Sbjct: 193 LVAGVGVESVFPLYSPNIKEIKVLD-RKKVRRAKLYYLRDRMNALRK 238 >ref|XP_004975505.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Setaria italica] Length = 225 Score = 82.4 bits (202), Expect = 1e-13 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIKVLD R KVRRAKLY+LR+RMNALRK Sbjct: 180 LVAGVGVESVFPLYSPNIKEIKVLD-RKKVRRAKLYYLRDRMNALRK 225 >gb|AFW61421.1| hypothetical protein ZEAMMB73_090575 [Zea mays] Length = 81 Score = 82.4 bits (202), Expect = 1e-13 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIKVLD R KVRRAKLY+LR+RMNALRK Sbjct: 36 LVAGVGVESVFPLYSPNIKEIKVLD-RKKVRRAKLYYLRDRMNALRK 81 >ref|NP_001046245.1| Os02g0205000 [Oryza sativa Japonica Group] gi|46390526|dbj|BAD16014.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|51536266|dbj|BAD38434.1| putative plastid ribosomal protein L19 precursor [Oryza sativa Japonica Group] gi|113535776|dbj|BAF08159.1| Os02g0205000 [Oryza sativa Japonica Group] gi|125538542|gb|EAY84937.1| hypothetical protein OsI_06303 [Oryza sativa Indica Group] gi|125581228|gb|EAZ22159.1| hypothetical protein OsJ_05821 [Oryza sativa Japonica Group] gi|215707036|dbj|BAG93496.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765566|dbj|BAG87263.1| unnamed protein product [Oryza sativa Japonica Group] Length = 222 Score = 81.3 bits (199), Expect = 2e-13 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIKVLD R KVRRAKLY+LR+RMNAL+K Sbjct: 177 LVAGVGVESVFPLYSPNIKEIKVLD-RKKVRRAKLYYLRDRMNALKK 222 >ref|XP_006647056.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Oryza brachyantha] Length = 222 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIK+LD R KVRRAKLY+LR+RMNAL+K Sbjct: 177 LVAGVGVESVFPLYSPNIKEIKILD-RKKVRRAKLYYLRDRMNALKK 222 >ref|XP_004956363.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Setaria italica] Length = 225 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIK+LD +N VRRAKLY+LR+RMNALRK Sbjct: 180 LVAGVGVESVFPLYSPNIKEIKILDRKN-VRRAKLYYLRDRMNALRK 225 >gb|EMT19516.1| 50S ribosomal protein L19, chloroplastic [Aegilops tauschii] Length = 242 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIK+LD R KVRRAKLY+LR+RMNAL+K Sbjct: 197 LVAGVGVESVFPLYSPNIKEIKILD-RKKVRRAKLYYLRDRMNALKK 242 >gb|EMS56595.1| 50S ribosomal protein L19, chloroplastic [Triticum urartu] Length = 192 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKE+K+LD R KVRRAKLY+LR+RMNALRK Sbjct: 147 LVAGVGVESVFPLYSPNIKEMKILD-RKKVRRAKLYYLRDRMNALRK 192 >gb|EMS54881.1| 50S ribosomal protein L19, chloroplastic [Triticum urartu] Length = 217 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIK+LD R KVRRAKLY+LR+RMNAL+K Sbjct: 172 LVAGVGVESVFPLYSPNIKEIKILD-RKKVRRAKLYYLRDRMNALKK 217 >ref|XP_003574965.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 212 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIK+LD R KVRRAKLY+LR+RMNAL+K Sbjct: 167 LVAGVGVESVFPLYSPNIKEIKILD-RKKVRRAKLYYLRDRMNALKK 212 >dbj|BAJ87120.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326520856|dbj|BAJ92791.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 217 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIK+LD R KVRRAKLY+LR+RMNAL+K Sbjct: 172 LVAGVGVESVFPLYSPNIKEIKILD-RKKVRRAKLYYLRDRMNALKK 217 >ref|XP_003563681.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] gi|721615007|ref|XP_010227552.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Brachypodium distachyon] Length = 217 Score = 80.5 bits (197), Expect = 4e-13 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKE+K+LD R KVRRAKLY+LR+RMNAL+K Sbjct: 172 LVAGVGVESVFPLYSPNIKEVKILD-RKKVRRAKLYYLRDRMNALKK 217 >ref|XP_008648368.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Zea mays] gi|413941641|gb|AFW74290.1| hypothetical protein ZEAMMB73_091168 [Zea mays] Length = 280 Score = 80.1 bits (196), Expect = 5e-13 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKEIKVLD R KVRRAKLY+LR+RMNAL++ Sbjct: 235 LVAGVGVESVFPLYSPNIKEIKVLD-RKKVRRAKLYYLRDRMNALKR 280 >ref|XP_010276951.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Nelumbo nucifera] Length = 273 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKE+KVLD + KVRRAKLY+LR++MNAL+K Sbjct: 227 LVAGVGVESVFPLYSPNIKEVKVLD-KKKVRRAKLYYLRDKMNALKK 272 >ref|XP_010260779.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015261|ref|XP_010260780.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015264|ref|XP_010260781.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015267|ref|XP_010260782.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015270|ref|XP_010260783.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015273|ref|XP_010260784.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015277|ref|XP_010260786.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015280|ref|XP_010260787.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015283|ref|XP_010260788.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015286|ref|XP_010260789.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015290|ref|XP_010260790.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015293|ref|XP_010260791.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015297|ref|XP_010260792.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] gi|720015300|ref|XP_010260793.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic [Nelumbo nucifera] Length = 145 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVESVFPLYSPNIKE+KVLD + KVRRAKLY+LR++MNAL+K Sbjct: 99 LVAGVGVESVFPLYSPNIKEVKVLD-KKKVRRAKLYYLRDKMNALKK 144 >ref|XP_002318674.2| hypothetical protein POPTR_0012s08870g [Populus trichocarpa] gi|550326692|gb|EEE96894.2| hypothetical protein POPTR_0012s08870g [Populus trichocarpa] Length = 242 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 +VAGVGVES+ PLYSPNIK+I+VLD R KVRRAKLY+LR+RMNAL+K Sbjct: 195 MVAGVGVESLLPLYSPNIKQIEVLDDRKKVRRAKLYYLRDRMNALKK 241 >ref|XP_012468707.1| PREDICTED: 50S ribosomal protein L19-1, chloroplastic-like [Gossypium raimondii] Length = 241 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALR 90 +VAGVGVES+FPLYSPNIKEIKVLD + KVRRAKLY+LRN+MNALR Sbjct: 197 MVAGVGVESLFPLYSPNIKEIKVLD-KKKVRRAKLYYLRNKMNALR 241 >gb|KJB08093.1| hypothetical protein B456_001G064300 [Gossypium raimondii] Length = 235 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALR 90 +VAGVGVES+FPLYSPNIKEIKVLD + KVRRAKLY+LRN+MNALR Sbjct: 191 MVAGVGVESLFPLYSPNIKEIKVLD-KKKVRRAKLYYLRNKMNALR 235 >ref|XP_002519953.1| 50S ribosomal protein L19, putative [Ricinus communis] gi|223540999|gb|EEF42557.1| 50S ribosomal protein L19, putative [Ricinus communis] Length = 248 Score = 77.8 bits (190), Expect = 3e-12 Identities = 39/47 (82%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LVAGVGVES+FPLYSPNIKEIKVLD + KVRRAKLY+LR++MNAL+K Sbjct: 202 LVAGVGVESLFPLYSPNIKEIKVLD-KKKVRRAKLYYLRDKMNALKK 247 >ref|XP_002444908.1| hypothetical protein SORBIDRAFT_07g001190 [Sorghum bicolor] gi|241941258|gb|EES14403.1| hypothetical protein SORBIDRAFT_07g001190 [Sorghum bicolor] Length = 236 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -3 Query: 227 LVAGVGVESVFPLYSPNIKEIKVLDTRNKVRRAKLYFLRNRMNALRK 87 LV+G+GVESVFPLYSPNIKEIK+LD R KVRRAKLY+LR+R+NAL+K Sbjct: 191 LVSGIGVESVFPLYSPNIKEIKILD-RKKVRRAKLYYLRDRVNALKK 236